Learn Polish Podcast: Recent Episodes

Roy Coughlan

Learn Polish from a Native Speaker teaching a foreigner.

View Details

In this episode, Ania and Roy chat about the 2026 World Cup (Mundial) — even though neither Ireland nor Poland qualified! They discuss football fandom, favourite players, predictions for who might win, and the unique three-country hosting arrangement between the USA, Mexico and Canada. A fun, casual conversation packed with sports and everyday Polish vocabulary.

🇵🇱 Perfect for: Intermediate Polish learners who want natural conversational Polish on current events and sport.

⏱️ TIMESTAMPS

0:00 - Welcome & intro: Roy's Saturday — gym, sauna & recording
1:00 - Small talk: Any weekend plans? Cider time!
1:30 - Topic intro: Mundial — the World Cup in Polish
2:00 - Why didn't Italy or Ireland qualify?
2:45 - Did Poland qualify? The Lewandowski heartbreak
3:30 - Has Poland ever been World Cup champions? A look back to '82/'86
4:15 - Is Roy a football fan? USA vs Iran & Brazil predictions
5:30 - Roy's football past: JD United — named after Jack Daniels!
6:30 - Who are the favourites to win in 2026?
7:15 - Past champions: Germany, Spain, France, Brazil, Argentina
7:45 - Roy's pick: Spain — never a boring game!
8:30 - Favourite players: Ronaldo vs Messi — does Roy have a favourite?
9:30 - Why atmosphere matters more when your country plays
10:15 - Match timing — midnight kick-offs for Mexico/Argentina/Canada games
11:00 - Where is the 2026 World Cup being held? Three countries explained
11:45 - Stadium concerns: concrete pitches & scaffolding seating
13:00 - Would Roy go to a match live? Past stadium experiences
13:45 - Upcoming Under-21 & women's matches in Łódź
14:15 - Ticket & hotel prices — is it worth it?
15:00 - Outro & do usłyszenia!

🤝 JOIN OUR LEARN POLISH PODCAST COMMUNITY

🌐 Website: https://www.learnpolishpodcast.com/
🎙️ Podbean: https://learnpolish.podbean.com/
▶️ YouTube: https://www.youtube.com/@learnpolish
📘 Facebook: https://www.facebook.com/learnpolishpodcast/
🎵 TikTok: https://www.tiktok.com/@roycoughlanpodcaster
📸 Instagram: https://www.instagram.com/learnpolishpodcast/

🎓 LEARN POLISH WITH ANIA — Teatro de Idiomas

Hi, I'm Ania, founder of Teatro de Idiomas! Learning Polish doesn't have to be boring — with us it's fun, inspiring, and exciting. We teach through Spanish, English, or Russian, so you learn Polish in a language you're already comfortable with.

📸 Instagram: https://www.instagram.com/teatrodeidiomas/
🌐 Website: https://teatrodeidiomas.pl/pl/

🎙️ ALL ABOUT ROY

🚀 PodFather Podcast Coach Community: https://www.skool.com/podfather/about
🧠 Brain Fitness & Unlock Your Potential: https://www.skool.com/brainfitness/about
🌐 Roy's Hub (Brain Gym & Virtual Assistants): https://roycoughlan.com/
🏫 Start Your Own Skool Academy: https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

#LearnPolish #PolishPodcast #LearnPolishPodcast #PolishLanguage #PolskiJęzyk #PoPolsku #PolishForForeigners #Mundial #WorldCup2026 #PiłkaNożna #FootballPolish #SoccerInPolish #Lewandowski #Ronaldo #Messi #PolishVocabulary #ConversationalPolish #EverydayPolish #PolishPhrases #LanguageLearning #LanguagePodcast #PolyglotLife #LearnLanguages #SportsInPolish #PolishCulture #PolishLessons #TeatroDeIdiomas #RoyCoughlan #PodFather #PodcastCoach #Episode612 #Top1Percent

View Details

In this episode, Ania and Roy dive into everyone's favourite topic — Wakacje (Vacation)! They chat about when they prefer to take their holidays, what comes to mind when they think of time off, and the classic debate: active holidays vs. lazy all-inclusive resorts. Roy shares his plans for Ibiza, while Ania admits she is firmly on "Team Lazy". Along the way, you'll learn plenty of Polish vocabulary for describing holidays, travel preferences, and relaxing. 🇵🇱 Perfect for: Beginner to intermediate Polish learners who want natural, conversational Polish on holidays, travel, and everyday life. 0:00 - Welcome to Learn Polish Podcast & intro0:28 - Small talk: How are you? What month is it?1:04 - When do holidays actually start?1:19 - Roy's preferred times for taking a holiday (avoiding the crowds!)1:43 - Roy's upcoming holiday plans: Ibiza in August2:07 - What will Roy do in Ibiza? Partying or meditating?2:25 - How many times a year does Roy go on holiday?2:56 - Are holidays necessary? The cost vs. the benefits of relaxing3:34 - Why taking a week off every three months is better than one long trip3:57 - Word associations: What comes to mind when you hear "wakacje"?4:17 - The difference between "wakacje" (summer holidays) and "urlop" (time off work)4:52 - Ania's associations: sun, beach, alcohol, music, and relaxing5:37 - The big debate: Team Sea or Team Mountains?6:18 - Roy's ideal holiday destination: a small, beautiful town by the sea6:55 - Active holidays vs. lazy holidays: Which team are you on?7:15 - Roy's active holiday in Turkey: football, swimming pools, and evening entertainment7:43 - Ania's ideal holiday: All-inclusive, open bar, and doing absolutely nothing! 8:34 - Question for the listeners: Active or lazy? Sea or mountains?8:54 - Outro: dreaming of holidays, thanks, and do widzenia! #LearnPolish #PolishPodcast #LearnPolishPodcast #PolishLanguage #PolskiJęzyk #PoPolsku #PolishForForeigners #Wakacje #SummerHolidays #Urlop #TravelPoland #PolishCulture #ActiveVsLazy #AllInclusive #TeamSea #TeamMountains #PolishVocabulary #ConversationalPolish #EverydayPolish #PolishPhrases #LanguageLearning #LanguagePodcast #PolyglotLife #LearnLanguages #PolishLife #TeatroDeIdiomas #RoyCoughlan #PodFather #PodcastCoach

View Details

In this episode, Ania and Roy tackle a topic close to every Polish learner's heart — the very first words and sounds you encounter when learning Polish! Roy shares his honest experience as a foreigner living in Poland: from the very first Polish word he ever heard (spoiler: it's a swear word!), to the hardest names and phrases to pronounce, to the hilarious story of using the wrong word at a very formal meeting. Along the way, Ania reveals the most common pronunciation mistakes her students make and explains why making mistakes is actually a vital part of the process. 🇵🇱 Perfect for: Beginner to intermediate Polish learners who want to laugh, relate, and learn from real-life Polish pronunciation challenges. 0:00 - Welcome to Learn Polish Podcast & intro (with a forgotten line!)0:42 - Today's topic: How does a foreigner perceive the Polish language?1:07 - Polish pronunciation: what makes it so distinctive?1:21 - Question 1: What was Roy's very first impression of Polish?1:40 - Roy's first Polish word ever heard — and it's a swear word!2:13 - Why is that word always the first one foreigners learn?2:45 - The rhythm and melody of Polish: "sz, sz, sz, sz..."3:35 - Top 5 hardest Polish words to pronounce: starting with Przemysław & Radosław4:35 - Roy's Polish learning journey: university course, private tutor & falling asleep on a ball!6:17 - More hard words: thinking in English and translating on the fly7:14 - The challenge when Poles just repeat the same word louder instead of rephrasing7:37 - Roy's most embarrassing Polish moment: saying "zajebiste" at a formal office meeting!8:23 - Ania's top hard words for students: "przepraszam" and "szczęście"9:09 - Confusing similar-sounding words: "brwi" (eyebrows) vs "drzwi" (doors)9:13 - "Kanapka" (sandwich) vs "kanapa" (sofa) — a classic mix-up9:49 - The student who said she waxes her "doors" instead of her eyebrows10:00 - Mistakes are part of the process — you have to make them to progress! 10:20 - Roy's memory trick: "smacznego" reminds him of Arnold Schwarzenegger 10:41 - Two types of difficulty: pronunciation (consonant clusters) vs vocabulary memory11:28 - Why Polish is harder for non-Slavic language speakers12:01 - Is it worth learning Polish? Roy's heartfelt answer12:30 - Question for listeners: What is your hardest Polish word to say or remember?13:08 - Outro & thanks #LearnPolish #PolishPodcast #LearnPolishPodcast #PolishLanguage #PolskiJęzyk #PoPolsku #PolishForForeigners #PolishPronunciation #HardPolishWords #LearnPolishPronunciation #PolishForBeginners #PolishVocabulary #FunnyPolish #PolishMistakes #ConversationalPolish #EverydayPolish #PolishPhrases #LanguageLearning #LanguagePodcast #PolyglotLife #LearnLanguages #PolishLife #TeatroDeIdiomas #RoyCoughlan #PodFather #PodcastCoach #Wymowa #SłowiańskieJęzyki

View Details

In this episode, Ania and Roy discuss the age-old debate: City or Village? They compare the pros and cons of living in a bustling city versus the peaceful countryside. Roy shares his experiences of living in a city in Ireland and his current life in a smaller town near Łódź, Poland. They cover vocabulary related to nature, city life, privacy, and the impact of our surroundings on our mental well-being. Plus, a surprise interruption from "hackers" 🇵🇱 Perfect for: Beginner to intermediate Polish learners who want natural, conversational Polish on lifestyle choices and everyday life. 0:00 - Welcome to Learn Polish Podcast & intro1:43 - Roy's recent trip to Ireland and transport troubles2:05 - Did Roy live in a city or village in Ireland?2:25 - Roy's current life near Łódź, Poland2:54 - The big question: City or Village? What does Roy prefer?3:07 - How preferences change from youth to adulthood3:40 - The pros and cons: Advantages of city life (business, networking)4:32 - The advantages of village life (peace, nature, privacy)5:46 - Enjoying nature: birds, foxes, and hedgehogs vs city rats6:05 - The disadvantages of village life: distance to hospitals and ambulances6:48 - Healthy living: buying directly from farmers7:20 - Technical difficulties! "Hackers" interrupt the podcast8:04 - Working from home and internet connectivity issues in the countryside8:55 - The disadvantages of city life: danger, smog, and traffic jams9:33 - Could Roy move back to a big city like Warsaw or central Łódź?10:18 - Does where you live affect your mental health and happiness?11:36 - The impact of corporate life, concrete jungles, and stressful bosses12:15 - You are not a tree! You can move and change your life12:57 - Question for the listeners: What is your preference? City, village, or small town?13:25 - Outro & thanks 🤝 JOIN OUR LEARN POLISH PODCAST COMMUNITY🌐 Website: https://www.learnpolishpodcast.com/🎙️ Podbean: https://learnpolish.podbean.com/▶️ YouTube: https://www.youtube.com/@learnpolish📘 Facebook: https://www.facebook.com/learnpolishpodcast/🎵 TikTok: https://www.tiktok.com/@roycoughlanpodcaster📸 Instagram: https://www.instagram.com/learnpolishpodcast/ 🎓 LEARN POLISH WITH ANIA — Teatro de IdiomasHi, I'm Ania, founder of Teatro de Idiomas! Learning Polish doesn't have to be boring — with us it's fun, inspiring, and exciting. We teach through Spanish, English, or Russian, so you learn Polish in a language you're already comfortable with. 📸 Instagram: https://www.instagram.com/teatrodeidiomas/ 🌐 Website: https://teatrodeidiomas.pl/pl/ 🎙️ ALL ABOUT ROY🚀 PodFather Podcast Coach Community: https://www.skool.com/podfather/about 🧠 Brain Fitness & Unlock Your Potential: https://www.skool.com/brainfitness/about 🌐 Roy's Hub (Brain Gym & Virtual Assistants ): https://roycoughlan.com/🏫 Start Your Own Skool Academy: https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71 #LearnPolish #PolishPodcast #LearnPolishPodcast #PolishLanguage #PolskiJęzyk #PoPolsku #PolishForForeigners #CityVsVillage #MiastoCzyWieś #PolandLife #PolishCulture #LivingInPoland #NatureVsCity #PolishVocabulary #ConversationalPolish #EverydayPolish #PolishPhrases #LanguageLearning #LanguagePodcast #PolyglotLife #LearnLanguages #PolishLife #TeatroDeIdiomas #RoyCoughlan #PodFather #PodcastCoach #MentalHealth #LifestyleChoices

View Details

In this remastered classic, Roy and Kamila bake cupcakes together — in Polish! This hands-on, practical episode teaches essential cooking and baking vocabulary through a real recipe. Fractions, ingredients, kitchen tools and oven temperatures — all po polsku. Delicious learning guaranteed!

🇵🇱 Perfect for: Beginner Polish learners who want fun, practical cooking and kitchen vocabulary.

⏱️ TIMESTAMPS

0:00 - Welcome & intro to LearnPolishPodcast.com

1:00 - Small talk: Co robimy dzisiaj? Robimy babeczki!

1:30 - Babeczki — cupcakes in Polish

2:00 - Miska (bowl) — first kitchen item

2:30 - Mąka (flour) — półtorej szklanki mąki (one and a half cups)

3:15 - Cukier (sugar) — trzy czwarte szklanki (three quarters of a cup)

3:45 - Brązowy vs biały cukier — brown sugar is healthier!

4:15 - Proszek do pieczenia (baking powder) — mała łyżeczka

4:45 - Olej (oil) — jedna trzecia szklanki (one third of a cup)

5:15 - Aromat pomarańczowy (orange extract) — kilka kropel (a few drops) 5:45 - Ocet (vinegar) — jedna łyżka

6:15 - Mieszamy! — to mix (mieszać)

6:45 - Piec — to bake (not the same as gotować!)

7:00 - Piekarnik (oven) — vocabulary & practice

7:30 - Temperature: 180 stopni (180 degrees)

7:45 - Baking time: 25 minut — czekamy!

8:15 - Looking forward to eating with Melissa tea!

8:30 - Outro & do zobaczenia!

🤝 JOIN OUR LEARN POLISH PODCAST COMMUNITY

🌐 Website: https://www.learnpolishpodcast.com/

🎙️ Podbean: https://learnpolish.podbean.com/

▶️ YouTube: https://www.youtube.com/@learnpolish

📘 Facebook: https://www.facebook.com/learnpolishpodcast/

🎵 TikTok: https://www.tiktok.com/@roycoughlanpodcaster

📸 Instagram: https://www.instagram.com/learnpolishpodcast/

🎓 LEARN POLISH WITH ANIA — Teatro de Idiomas

Hi, I'm Ania, founder of Teatro de Idiomas! Learning Polish doesn't have to be boring — with us it's fun, inspiring, and exciting. We teach through Spanish, English, or Russian, so you learn Polish in a language you're already comfortable with.

📸 Instagram: https://www.instagram.com/teatrodeidiomas/ 🌐 Website: https://teatrodeidiomas.pl/pl/

🎙️ ALL ABOUT ROY

🚀 PodFather Podcast Coach Community: https://www.skool.com/podfather/about 🧠 Brain Fitness & Unlock Your Potential: https://www.skool.com/brainfitness/about 🌐 Roy's Hub (Brain Gym & Virtual Assistants): https://roycoughlan.com/ 🏫 Start Your Own Skool Academy: https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

#LearnPolish #PolishPodcast #LearnPolishPodcast #PolishLanguage #PolskiJęzyk #PoPolsku #PolishForForeigners #Babeczki #Cupcakes #BakingInPolish #PolishCooking #PolishKitchen #Piekarnik #Mąka #PolishRecipe #CookingVocabulary #PolishVocabulary #ConversationalPolish #EverydayPolish #PolishPhrases #LanguageLearning #LanguagePodcast #PolyglotLife #LearnLanguages #Remastered #ClassicEpisode #BeginnerPolish #PolishCulture #PolishLessons #TeatroDeIdiomas #RoyCoughlan #PodFather #PodcastCoach #Episode608 #Top1Percent

View Details

In this remastered classic, Roy and Kamila are live in the kitchen! While making tea together, they cover all the essential Polish vocabulary for dishes, kitchen utensils and cookware. A fun, practical episode filmed in real time — perfect for everyday Polish learners.

🇵🇱 Perfect for: Beginner Polish learners who want practical, hands-on kitchen and household vocabulary.

⏱️ TIMESTAMPS

0:00 - Welcome & intro to LearnPolishPodcast.com

1:00 - Small talk: Jesteśmy w mojej kuchni!

1:30 - Czy chcesz herbatę? — making tea in Polish

2:00 - Czajnik (kettle) — vocabulary & practice

2:30 - Biorę czajnik — I take the kettle

3:00 - Nalewam wodę — I pour the water

3:30 - Gotuję wodę — I boil the water (double meaning: cook & boil!)

4:15 - Kubek (mug) — what kind of tea do you like?

5:00 - Owocowa, czarna herbata, Melissa (herbal tea) — types of tea

5:45 - Melissa zioło — herb for relaxation (Roy prefers meditation!)

6:30 - Zmywarka (dishwasher) — a very useful word!

7:00 - Zmywać naczynia — to wash the dishes

7:30 - Talerz (plate) & garnek (pot)

8:00 - Patelnia (frying pan)

8:30 - Kubek vs szklanka (mug vs glass)

9:00 - Łyżka (spoon) & łyżeczka (teaspoon)

9:45 - Nóż (knife)

10:15 - Outro & do widzenia!

🤝 JOIN OUR LEARN POLISH PODCAST COMMUNITY

🌐 Website: https://www.learnpolishpodcast.com/

🎙️ Podbean: https://learnpolish.podbean.com/

▶️ YouTube: https://www.youtube.com/@learnpolish

📘 Facebook: https://www.facebook.com/learnpolishpodcast/

🎵 TikTok: https://www.tiktok.com/@roycoughlanpodcaster

📸 Instagram: https://www.instagram.com/learnpolishpodcast/

🎓 LEARN POLISH WITH ANIA — Teatro de Idiomas

Hi, I'm Ania, founder of Teatro de Idiomas! Learning Polish doesn't have to be boring — with us it's fun, inspiring, and exciting. We teach through Spanish, English, or Russian, so you learn Polish in a language you're already comfortable with.

📸 Instagram: https://www.instagram.com/teatrodeidiomas/ 🌐 Website: https://teatrodeidiomas.pl/pl/

🎙️ ALL ABOUT ROY

🚀 PodFather Podcast Coach Community: https://www.skool.com/podfather/about 🧠 Brain Fitness & Unlock Your Potential: https://www.skool.com/brainfitness/about 🌐 Roy's Hub (Brain Gym & Virtual Assistants): https://roycoughlan.com/ 🏫 Start Your Own Skool Academy: https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

#LearnPolish #PolishPodcast #LearnPolishPodcast #PolishLanguage #PolskiJęzyk #PoPolsku #PolishForForeigners #Naczynia #PolishKitchen #KitchenPolish #Czajnik #Talerz #Patelnia #Zmywarka #PolishVocabulary #ConversationalPolish #EverydayPolish #PolishPhrases #LanguageLearning #LanguagePodcast #PolyglotLife #LearnLanguages #Remastered #ClassicEpisode #BeginnerPolish #PolishCulture #PolishLessons #TeatroDeIdiomas #RoyCoughlan #PodFather #PodcastCoach #Episode607 #Top1Percent

View Details

In this remastered classic, Roy and Kamila dive into the world of Polish humour! They discuss what makes things funny, Roy's love of The Simpsons, the difference between black and white humour, and how to tell jokes in Polish. Plus Roy shares his mum's legendary umbrella prank — and Kamila teaches the classic Polish joke opener: Przychodzi baba do lekarza...

🇵🇱 Perfect for: Beginner to intermediate Polish learners who want fun, natural conversational Polish.

⏱️ TIMESTAMPS

0:00 - Welcome & intro to Learn Polish Podcast

1:00 - Small talk: Jesteś gotowy żeby uczyć się polskiego?

1:45 - Today's topic: Humor — poczucie humoru (sense of humour)

2:30 - Co jest dla ciebie śmieszne? (What do you find funny?)

3:00 - Śmieszne vs zabawne — two ways to say funny in Polish

3:30 - Roy's favourite comedy: The Simpsons & why

4:30 - Czarny humor vs biały humor (black vs white humour)

5:15 - Roy's mum's legendary umbrella prank — the full story!

7:00 - Robić żarty — to make jokes (vocabulary & practice)

8:00 - Opowiadać dowcipy — to tell jokes (pronunciation challenge!)

9:30 - Przychodzi baba do lekarza — classic Polish joke format

10:30 - Śmiać się z siebie — can you laugh at yourself?

11:15 - Dystans do siebie — having perspective about yourself

11:45 - Kamila's verdict: "Najgorszy podcast na całym świecie!"

12:00 - Outro & do widzenia!

🤝 JOIN OUR LEARN POLISH PODCAST COMMUNITY

🌐 Website: https://www.learnpolishpodcast.com/

🎙️ Podbean: https://learnpolish.podbean.com/

▶️ YouTube: https://www.youtube.com/@learnpolish

📘 Facebook: https://www.facebook.com/learnpolishpodcast/

🎵 TikTok: https://www.tiktok.com/@roycoughlanpodcaster

📸 Instagram: https://www.instagram.com/learnpolishpodcast/

🎓 LEARN POLISH WITH ANIA — Teatro de Idiomas

Hi, I'm Ania, founder of Teatro de Idiomas! Learning Polish doesn't have to be boring — with us it's fun, inspiring, and exciting. We teach through Spanish, English, or Russian, so you learn Polish in a language you're already comfortable with.

📸 Instagram: https://www.instagram.com/teatrodeidiomas/ 🌐 Website: https://teatrodeidiomas.pl/pl/

🎙️ ALL ABOUT ROY

🚀 PodFather Podcast Coach Community: https://www.skool.com/podfather/about 🧠 Brain Fitness & Unlock Your Potential: https://www.skool.com/brainfitness/about 🌐 Roy's Hub (Brain Gym & Virtual Assistants): https://roycoughlan.com/ 🏫 Start Your Own Skool Academy: https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

#LearnPolish #PolishPodcast #LearnPolishPodcast #PolishLanguage #PolskiJęzyk #PoPolsku #PolishForForeigners #PoczucieHumoru #PolishHumour #Dowcipy #PolishJokes #CzarnyHumor #PrzychodziDoBabyLekarza #ŚmiesznePoPolsku #PolishVocabulary #ConversationalPolish #EverydayPolish #PolishPhrases #LanguageLearning #LanguagePodcast #PolyglotLife #LearnLanguages #Remastered #ClassicEpisode #PolishCulture #PolishComedy #PolishLessons #TeatroDeIdiomas #RoyCoughlan #PodFather #PodcastCoach #Episode606 #Top1Percent

View Details

In this remastered classic, Roy and Kamila walk through everything you need to know about finding and renting a property in Poland — in Polish! From writing a rental listing to describing your ideal apartment, this episode covers essential vocabulary for anyone planning to live in Poland. Practical, real and immediately useful.

🇵🇱 Perfect for: Beginner to intermediate Polish learners planning to live, work or study in Poland.

⏱️ TIMESTAMPS

0:00 - Welcome & intro to Learn Polish Podcast

1:00 - Small talk: Roy has a voice problem!

1:45 - Topic intro: Renting a flat in Poland — who needs this?

2:30 - Key word: Ogłoszenie (advertisement/listing)

3:00 - Szukać — to look for (conjugation practice)

3:45 - Types of apartment: jednopokojowe, dwupokojowe, trzypokojowe 4:30 - Important cultural note: how Poles count rooms differently

5:30 - Roy describes his ideal apartment: 100m², 2 bedrooms, open kitchen, garage

6:30 - Po remoncie vs do remontu (after renovation vs needs renovation)

7:15 - Location vocabulary: w centrum, blisko centrum, 20 minut od centrum

8:00 - Types of property: mieszkanie, blok (old & new), dom rodzinny

9:00 - Bliźniak — semi-detached house explained

9:45 - Do wynajęcia — to rent

10:15 - Balkon, taras, bez balkonu — outdoor space vocabulary

11:00 - Roy's must-haves: 2 sypialnie, salon, kuchnia, łazienka

11:45 - Ogród (garden): trawnik, rośliny — beautiful but lots of work!

12:30 - Nie lubię kosić trawy — Roy's gardening confession

13:00 - Final summary: how to write your perfect rental listing in Polish

13:30 - Outro: powodzenia & do widzenia!

🤝 JOIN OUR LEARN POLISH PODCAST COMMUNITY

🌐 Website: https://www.learnpolishpodcast.com/ 🎙️ Podbean: https://learnpolish.podbean.com/ ▶️ YouTube: https://www.youtube.com/@learnpolish 📘 Facebook: https://www.facebook.com/learnpolishpodcast/ 🎵 TikTok: https://www.tiktok.com/@roycoughlanpodcaster 📸 Instagram: https://www.instagram.com/learnpolishpodcast/

🎓 LEARN POLISH WITH ANIA — Teatro de Idiomas

Hi, I'm Ania, founder of Teatro de Idiomas! Learning Polish doesn't have to be boring — with us it's fun, inspiring, and exciting. We teach through Spanish, English, or Russian, so you learn Polish in a language you're already comfortable with.

📸 Instagram: https://www.instagram.com/teatrodeidiomas/ 🌐 Website: https://teatrodeidiomas.pl/pl/

🎙️ ALL ABOUT ROY

🚀 PodFather Podcast Coach Community: https://www.skool.com/podfather/about 🧠 Brain Fitness & Unlock Your Potential: https://www.skool.com/brainfitness/about 🌐 Roy's Hub (Brain Gym & Virtual Assistants): https://roycoughlan.com/ 🏫 Start Your Own Skool Academy: https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

#LearnPolish #PolishPodcast #LearnPolishPodcast #PolishLanguage #PolskiJęzyk #PoPolsku #PolishForForeigners #SzukamMieszkania #RentingInPoland #ApartmentPolish #MieszkanieDoWynajęcia #PolishProperty #BliźniakPolish #PoRemoncie #PolishVocabulary #ConversationalPolish #EverydayPolish #PolishPhrases #LanguageLearning #LanguagePodcast #PolyglotLife #LearnLanguages #Remastered #ClassicEpisode #LivingInPoland #PolishForExpats #PolishLessons #TeatroDeIdiomas #RoyCoughlan #PodFather #PodcastCoach #Episode605 #Top1Percent

View Details

In this remastered classic, Roy and Kamila go room by room through a Polish home — covering all the essential furniture and household vocabulary you need. From the living room to the kitchen to the bathroom, this episode is a must for anyone learning everyday Polish. Plus, watch out for the classic mix-up between kanapa (sofa) and kanapka (sandwich)

🇵🇱 Perfect for: Beginner Polish learners who want practical, everyday household vocabulary.

⏱️ TIMESTAMPS

0:00 - Welcome & intro to Learn Polish Podcast

1:00 - Small talk: Jak się masz? Bardzo dobrze!

1:45 - Today's topic: Meble — Furniture in Polish

2:15 - Stół (table) & krzesło (chair)

2:45 - Lampa (lamp) & zasłona (curtain)

3:30 - Kanapa (sofa) vs kanapka (sandwich) — the classic mix-up!

4:30 - Fotel (armchair) & szafka (cabinet) 5:00 - Regał (bookshelf) — a very important word!

5:30 - Łóżko (bed) & szafa (wardrobe)

6:15 - What's in Roy's salon (living room)?

7:00 - Telewizor, stolik, kanapa, biurko (desk)

7:45 - Krzesło biurowe (office chair)

8:15 - Zegar (clock) & szafa in the living room

9:00 - Sypialnia (bedroom) vocabulary

9:30 - Łóżko, lampka nocna (night lamp)

10:00 - Szafka nocna (bedside table)

10:30 - Kuchnia (kitchen) vocabulary

11:00 - Lodówka (fridge), piekarnik (oven), kuchenka (hob/stove)

11:45 - Kuchenka elektryczna vs kuchenka gazowa

12:15 - Czajnik (kettle) — Roy's first time hearing this word!

13:00 - Łazienka (bathroom): wanna, prysznic, toaleta, umywalka 13:45 - Bidet & lustro (mirror)

14:15 - Outro & do widzenia

🤝 JOIN OUR LEARN POLISH PODCAST COMMUNITY

🌐 Website: https://www.learnpolishpodcast.com/

🎙️ Podbean: https://learnpolish.podbean.com/

▶️ YouTube: https://www.youtube.com/@learnpolish

📘 Facebook: https://www.facebook.com/learnpolishpodcast/

🎵 TikTok: https://www.tiktok.com/@roycoughlanpodcaster

📸 Instagram: https://www.instagram.com/learnpolishpodcast/

🎓 LEARN POLISH WITH ANIA — Teatro de Idiomas

Hi, I'm Ania, founder of Teatro de Idiomas! Learning Polish doesn't have to be boring — with us it's fun, inspiring, and exciting. We teach through Spanish, English, or Russian, so you learn Polish in a language you're already comfortable with.

📸 Instagram: https://www.instagram.com/teatrodeidiomas/ 🌐 Website: https://teatrodeidiomas.pl/pl/

🎙️ ALL ABOUT ROY

🚀 PodFather Podcast Coach Community: https://www.skool.com/podfather/about 🧠 Brain Fitness & Unlock Your Potential: https://www.skool.com/brainfitness/about 🌐 Roy's Hub (Brain Gym & Virtual Assistants): https://roycoughlan.com/ 🏫 Start Your Own Skool Academy: https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

#LearnPolish #PolishPodcast #LearnPolishPodcast #PolishLanguage #PolskiJęzyk #PoPolsku #PolishForForeigners #Meble #PolishHome #HouseInPolish #FurniturePolish #PolishVocabulary #ConversationalPolish #EverydayPolish #PolishPhrases #LanguageLearning #LanguagePodcast #PolyglotLife #LearnLanguages #Remastered #ClassicEpisode #PolishRooms #KuchniaSypialnia #ŁazienkaPolish #BeginnerPolish #PolishLessons #TeatroDeIdiomas #RoyCoughlan #PodFather #PodcastCoach #Episode604 #Top1Percent

View Details

In this remastered classic, Roy and Kamila cover one of the most essential topics in Polish culture — życzenia (wishes)! From birthdays to name days, learn how Poles celebrate, what they say, and how to sing the iconic Sto Lat song. Perfect practical Polish you will use again and again!

🇵🇱 Perfect for: Beginner Polish learners who want essential everyday vocabulary for celebrations and greetings.

⏱️ TIMESTAMPS

0:00 - Welcome & intro to Learn Polish Podcast

1:00 - Small talk: Jak się czujesz? Bardzo dobrze!

1:45 - Today's topic: Życzenia — Wishes in Polish

2:15 - Different occasions: różne okazje

2:45 - Urodziny (birthday) — when is yours?

3:30 - Roy's birthday: 4th October / Kamila's: 18th July

4:15 - Imieniny — Polish name day tradition explained

5:00 - Składać życzenia — how to give wishes in Polish

5:45 - Wszystkiego najlepszego (all the best)

6:15 - Dużo szczęścia (lots of luck) 6:30 - Dużo miłości (lots of love)

6:45 - Dużo pieniędzy (lots of money!)

7:00 - Dużo sukcesów (lots of success)

7:30 - Sto Lat — Poland's iconic birthday song explained

8:30 - Singing Sto Lat together!

10:00 - Practice round: Roy gives birthday wishes to Kamila

11:00 - Dużo zdrowia, miłości, satysfakcji & dobrych studentów!

11:30 - Outro & do widzenia

🤝 JOIN OUR LEARN POLISH PODCAST COMMUNITY

🌐 Website: https://www.learnpolishpodcast.com/

🎙️ Podbean: https://learnpolish.podbean.com/

▶️ YouTube: https://www.youtube.com/@learnpolish

📘 Facebook: https://www.facebook.com/learnpolishpodcast/

🎵 TikTok: https://www.tiktok.com/@roycoughlanpodcaster

📸 Instagram: https://www.instagram.com/learnpolishpodcast/

🎓 LEARN POLISH WITH ANIA — Teatro de Idiomas

Hi, I'm Ania, founder of Teatro de Idiomas! Learning Polish doesn't have to be boring — with us it's fun, inspiring, and exciting. We teach through Spanish, English, or Russian, so you learn Polish in a language you're already comfortable with.

📸 Instagram: https://www.instagram.com/teatrodeidiomas/ 🌐 Website: https://teatrodeidiomas.pl/pl/

🎙️ ALL ABOUT ROY

🚀 PodFather Podcast Coach Community: https://www.skool.com/podfather/about 🧠 Brain Fitness & Unlock Your Potential: https://www.skool.com/brainfitness/about 🌐 Roy's Hub (Brain Gym & Virtual Assistants): https://roycoughlan.com/ 🏫 Start Your Own Skool Academy: https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

#LearnPolish #PolishPodcast #LearnPolishPodcast #PolishLanguage #PolskiJęzyk #PoPolsku #PolishForForeigners #Życzenia #StoLat #PolishWishes #WszystkiegoNajlepszego #Urodziny #Imieniny #HappyBirthdayPolish #PolishTraditions #PolishCulture #PolishVocabulary #ConversationalPolish #EverydayPolish #PolishPhrases #LanguageLearning #LanguagePodcast #PolyglotLife #LearnLanguages #Remastered #ClassicEpisode #PolishCelebrations #PolishLessons #TeatroDeIdiomas #RoyCoughlan #PodFather #PodcastCoach #Episode603 #Top1Percent

View Details

In this episode, Ania and Roy tackle one of the hottest debates of the digital age — is being an influencer a real job? They discuss what influencers actually do, the role of creativity vs controversy, platform censorship, and whether influencers are celebrities or salespeople. Packed with modern, relevant Polish vocabulary around social media, work, and digital life.

🇵🇱 Perfect for: Intermediate Polish learners who want natural conversational Polish on modern, relevant topics.

⏱️ TIMESTAMPS

0:00 - Welcome & intro to LearnPolishPodcast.com

1:00 - Small talk: Roy's school reunion trip to Ireland

2:30 - Zjazd absolwentów — school reunion in Polish

3:30 - WhatsApp groups, Zoom & reconnecting after years

5:00 - Roy's glow up story — four weeks of gym, no weddings!

6:30 - Topic intro: Influencers & social media

7:00 - What is an influencer? Wpływ — the Polish connection

8:30 - Question 1: Is being an influencer a real job?

10:00 - Creativity, consistency & the reality of the work

11:30 - Platform censorship — Roy's experience on TikTok, YouTube & Facebook 13:30 - The danger of relying on platforms for income

15:00 - Question 2: Are influencers celebrities or salespeople?

16:30 - Roy's example: the Irish comedian with 5 Christmas #1s

18:00 - Positive vs negative content — what feels good to watch?

19:30 - Question 3: Talent or controversy — what matters more?

21:00 - How controversy drives engagement & platform algorithms

22:30 - Trump example: 50/50 split drives more comments & reach

24:00 - Roy's final thought: kids growing up wanting to be influencers

25:30 - Wtrącenie — Roy's bonus insight on digital natives

26:00 - Listener question & call to action

26:30 - Outro & do usłyszenia!

🤝 JOIN OUR LEARN POLISH PODCAST COMMUNITY

🌐 Website: https://www.learnpolishpodcast.com/ 🎙️ Podbean: https://learnpolish.podbean.com/ ▶️ YouTube: https://www.youtube.com/@learnpolish 📘 Facebook: https://www.facebook.com/learnpolishpodcast/ 🎵 TikTok: https://www.tiktok.com/@roycoughlanpodcaster 📸 Instagram: https://www.instagram.com/learnpolishpodcast/

🎓 LEARN POLISH WITH ANIA — Teatro de Idiomas

Hi, I'm Ania, founder of Teatro de Idiomas! Learning Polish doesn't have to be boring — with us it's fun, inspiring, and exciting. We teach through Spanish, English, or Russian, so you learn Polish in a language you're already comfortable with.

📸 Instagram: https://www.instagram.com/teatrodeidiomas/ 🌐 Website: https://teatrodeidiomas.pl/pl/

🎙️ ALL ABOUT ROY

🚀 PodFather Podcast Coach Community: https://www.skool.com/podfather/about 🧠 Brain Fitness & Unlock Your Potential: https://www.skool.com/brainfitness/about 🌐 Roy's Hub (Brain Gym & Virtual Assistants): https://roycoughlan.com/ 🏫 Start Your Own Skool Academy: https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

#LearnPolish #PolishPodcast #LearnPolishPodcast #PolishLanguage #PolskiJęzyk #PoPolsku #PolishForForeigners #Influencer #Influencerzy #SocialMediaPolish #MediaSpołecznościowe #InfluencerJob #PolishVocabulary #ConversationalPolish #EverydayPolish #PolishPhrases #LanguageLearning #LanguagePodcast #PolyglotLife #LearnLanguages #DigitalLife #Cenzura #PlatformCensorship #PolishCulture #PolishLessons #ModernPolish #TeatroDeIdiomas #RoyCoughlan #PodFather #PodcastCoach #Episode602 #Top1Percent

View Details

In this remastered classic, Roy and Kamila get into the spirit of Valentine's Day — teaching you all the romantic Polish phrases and compliments you need! From "Kocham Cię" to "Jesteś cudowna", this episode is packed with practical, fun vocabulary perfect for the 14th of February — or any day you want to impress someone special.

🇵🇱 Perfect for: Beginner Polish learners who want fun, practical romantic vocabulary.

Today we will talk about Valentine's day - Dzisiaj porozmawiamy o Walentynkach

Tomorrow is Valentine's day - Jutro są Walentynki

I Love You - Kocham Cię

I like you - lubię cię

I like your appearance - Podoba mi się twój wygląd

You are beautiful - Jesteś piękna

You are pretty - Jesteś ładna

You are amazing - Jesteś niesamowity

You are wonderful - Jesteś wspaniały

You have beautiful eyes - Masz piękne oczy

You have a beautiful smile - Masz piękny uśmiech

Your hair is very beautiful - Twoje włosy są bardzo piękne

You are very handsome - Jesteś bardzo przystojny

I know - wiem

You are very pretty - Jesteś bardzo ładna

14th of February - 14 lutego

Tomorrow is Valentine's day - Jutro są Walentynki

You can buy a card and write I love you - Możesz kupić kartę i napisać, że Cię kocham

You are very pretty - Jesteś bardzo ładna

You can buy flowers - Możesz kupić kwiaty

A rose - Róża

and Roy are you buying a rose tomorrow - a Roy kupujesz jutro różę

No I am single - Nie, jestem sam

Good grammer - Dobry gramatyk

You don't have a valentine - Nie masz walentynek

All the best of valentine's day to all our listeners - Wszystkiego najlepszego z okazji walentynek dla wszystkich naszych słuchaczy

If you would like Skype lessons from kamila please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Polish Property & business Offers - http://roycoughlan.com/

⏱️ TIMESTAMPS

0:00 - Welcome & intro to Learn Polish Podcast

1:00 - Small talk: Co słychać? Wszystko w porządku!

1:45 - Today's topic: Walentynki — Valentine's Day!

2:30 - Key phrase: Jutro są walentynki (Tomorrow is Valentine's Day)

3:00 - Kocham Cię (I love you) — pronunciation practice

3:45 - Lubię Cię (I like you)

4:15 - Podobasz mi się (I fancy you / You appeal to me)

5:00 - Jesteś piękna / ładna (You are beautiful)

5:45 - Jesteś cudowna / wspaniała (You are wonderful / amazing)

6:30 - Masz piękne oczy (You have beautiful eyes)

7:00 - Masz piękny uśmiech (You have a beautiful smile)

7:45 - Compliments for men: Jesteś przystojny (You are handsome)

8:30 - Valentine's Day traditions: kartka, kwiaty, róże

9:00 - Roy's Valentine's status: Jestem singlem!

9:30 - Outro & Valentine's wishes for all listeners

🤝 JOIN OUR LEARN POLISH PODCAST COMMUNITY

🌐 Website: https://www.learnpolishpodcast.com/

🎙️ Podbean: https://learnpolish.podbean.com/

▶️ YouTube: https://www.youtube.com/@learnpolish

📘 Facebook: https://www.facebook.com/learnpolishpodcast/

🎵 TikTok: https://www.tiktok.com/@roycoughlanpodcaster

📸 Instagram: https://www.instagram.com/learnpolishpodcast/

🎓 LEARN POLISH WITH ANIA — Teatro de Idiomas

Hi, I'm Ania, founder of Teatro de Idiomas! Learning Polish doesn't have to be boring — with us it's fun, inspiring, and exciting. We teach through Spanish, English, or Russian, so you learn Polish in a language you're already comfortable with.

📸 Instagram: https://www.instagram.com/teatrodeidiomas/

🌐 Website: https://teatrodeidiomas.pl/pl/

🎙️ ALL ABOUT ROY

🚀 PodFather Podcast Coach Community: https://www.skool.com/podfather/about 🧠 Brain Fitness & Unlock Your Potential: https://www.skool.com/brainfitness/about 🌐 Roy's Hub (Brain Gym & Virtual Assistants): https://roycoughlan.com/

🏫 Start Your Own Skool Academy: https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

#LearnPolish #PolishPodcast #LearnPolishPodcast #PolishLanguage #PolskiJęzyk #PoPolsku #PolishForForeigners #Walentynki #ValentinesDay #KochamCię #PolishRomance #LoveInPolish #PolishCompliments #JesteśCudowna #PolishPhrases #PolishVocabulary #ConversationalPolish #EverydayPolish #LanguageLearning #LanguagePodcast #PolyglotLife #LearnLanguages #Remastered #ClassicEpisode #PolishCulture #PolishLessons #RomanticPolish #ValentinePolish #TeatroDeIdiomas #RoyCoughlan #PodFather #PodcastCoach #Episode601 #Top1Percent

View Details

In this episode recorded live on 1st May, Ania and Roy talk about one of Poland's most beloved holiday periods — Majówka, the May long weekend. They break down what happens on each of the three days (1st, 2nd and 3rd May), what Poles actually do to celebrate, and cover loads of everyday Polish vocabulary around holidays, traditions, food, and free time.

🇵🇱 Perfect for: Beginner to intermediate Polish learners who want natural, conversational Polish on culture and everyday life.

0:00 - Welcome & intro recorded live on 1st May

1:00 - Small talk: How are you? Co tam u Ciebie?

2:00 - Roy's morning: gym, sunshine & plans for a BBQ

3:30 - What is Majówka? Poland's May long weekend explained

5:00 - 1st May — Święto Pracy (Labour Day): why shops are closed

7:00 - Is Żabka always open? Even during nuclear war! 8:30 - 2nd May — Dzień Flagi Polskiej (Polish Flag Day)

10:00 - Polish flag colours: biało-czerwona — don't mix it up with Indonesia!

11:30 - 3rd May — Święto Konstytucji (Constitution Day)

13:00 - What do Poles do on Majówka? Stereotypes vs reality

14:30 - Grill + piwo = the ultimate Majówka combo

16:00 - Trips, travel & public Majówka events in villages and towns

18:00 - Festyn food: kiełbasa, frytki, gofry, lody...

19:30 - Roy's Majówka plans: gym, books & relaxing in the garden

21:00 - Bank holidays in Ireland vs Poland — a cultural difference

22:30 - Outro: enjoy the sunshine, leave a comment & do widzenia!

🤝 JOIN OUR LEARN POLISH PODCAST COMMUNITY

🌐 Website: https://www.learnpolishpodcast.com/ 🎙️ Podbean: https://learnpolish.podbean.com/ ▶️ YouTube: https://www.youtube.com/@learnpolish 📘 Facebook: https://www.facebook.com/learnpolishpodcast/ 🎵 TikTok: https://www.tiktok.com/@roycoughlanpodcaster 📸 Instagram: https://www.instagram.com/learnpolishpodcast/

🎓 LEARN POLISH WITH ANIA — Teatro de Idiomas

Hi, I'm Ania, founder of Teatro de Idiomas! Learning Polish doesn't have to be boring — with us it's fun, inspiring, and exciting. We teach through Spanish, English, or Russian, so you learn Polish in a language you're already comfortable with.

📸 Instagram: https://www.instagram.com/teatrodeidiomas/ 🌐 Website: https://teatrodeidiomas.pl/pl/

🎙️ ALL ABOUT ROY

🚀 PodFather Podcast Coach Community: https://www.skool.com/podfather/about 🧠 Brain Fitness & Unlock Your Potential: https://www.skool.com/brainfitness/about 🌐 Roy's Hub (Brain Gym & Virtual Assistants): https://roycoughlan.com/ 🏫 Start Your Own Skool Academy: https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

#LearnPolish #PolishPodcast #LearnPolishPodcast #PolishLanguage #PolskiJęzyk #PoPolsku #PolishForForeigners #Majówka #MayWeekend #PolandHolidays #PolishCulture #ŚwiętoKonstytucji #ŚwiętoPracy #DzieńFlagi #PolishFlag #LabourDay #ConstitutionDay #PolishTraditions #PolishVocabulary #ConversationalPolish #EverydayPolish #PolishPhrases #LanguageLearning #LanguagePodcast #PolyglotLife #LearnLanguages #PolishLife #PolishFood #Festyn #TeatroDeIdiomas #RoyCoughlan #PodFather #PodcastCoach #Episode599 #Top1Percent

View Details

🎉 Episode 600 — a huge milestone! In this remastered classic, Roy and Kamila explore one of the most fun travel debates: seaside or mountains? Along the way you'll pick up essential Polish vocabulary for travel, seasons, outdoor activities, and transport. Perfect natural conversational Polish for learners at any level.

🇵🇱 Perfect for: Beginner to intermediate Polish learners who want practical, everyday travel vocabulary.

⏱️ TIMESTAMPS

0:00 - Welcome & intro to Learn Polish Podcast

1:00 - Small talk: How are you? Co słychać?

1:45 - Today's topic: Do you like to travel? Morze czy Góry?

2:30 - Key vocabulary: morze (sea) & góry (mountains)

3:00 - Learning the verb "woleć" — to prefer

4:00 - Roy's answer: it depends on the weather & season!

4:45 - Seasons in Polish: zima, wiosna, lato, jesień

5:30 - Summer at the seaside: what can we do? (pływać, opalać się...)

7:00 - Building sandcastles: zamki z piasku

7:30 - Water sports: pływać żaglówką (sailing)

8:15 - Beach volleyball: siatkówka

9:00 - Eating ice cream: jeść lody

9:30 - Winter in the mountains: jeździć na nartach (skiing)

10:30 - Hiking & nature: spacerować, oglądać przyrodę i zwierzęta

11:30 - Tent or hotel? Sleeping under the stars vs comfort

12:30 - Robaki (insects) — why Roy prefers a hotel!

13:30 - Torches & camping: latarka

14:00 - How do you like to travel? Samochodem, autobusem, pociągiem, samolotem? 15:30 - Why Roy dislikes trains: too noisy to read! 16:30 - Outro & farewell: Do widzenia!

🤝 JOIN OUR LEARN POLISH PODCAST COMMUNITY

🌐 Website: https://www.learnpolishpodcast.com/ 🎙️ Podbean: https://learnpolish.podbean.com/ ▶️ YouTube: https://www.youtube.com/@learnpolish 📘 Facebook: https://www.facebook.com/learnpolishpodcast/ 🎵 TikTok: https://www.tiktok.com/@roycoughlanpodcaster 📸 Instagram: https://www.instagram.com/learnpolishpodcast/

🎓 LEARN POLISH WITH ANIA — Teatro de Idiomas

Hi, I'm Ania, founder of Teatro de Idiomas! Learning Polish doesn't have to be boring — with us it's fun, inspiring, and exciting. We teach through Spanish, English, or Russian, so you learn Polish in a language you're already comfortable with.

📸 Instagram: https://www.instagram.com/teatrodeidiomas/ 🌐 Website: https://teatrodeidiomas.pl/pl/

🎙️ ALL ABOUT ROY

🚀 PodFather Podcast Coach Community: https://www.skool.com/podfather/about 🧠 Brain Fitness & Unlock Your Potential: https://www.skool.com/brainfitness/about 🌐 Roy's Hub (Brain Gym & Virtual Assistants): https://roycoughlan.com/ 🏫 Start Your Own Skool Academy: https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

#LearnPolish #PolishPodcast #LearnPolishPodcast #PolishLanguage #PolskiJęzyk #PoPolsku #PolishForForeigners #MorzeczyGóry #SeasideOrMountain #PolishTravel #TravelInPolish #PolishVocabulary #ConversationalPolish #EverydayPolish #PolishPhrases #LanguageLearning #LanguagePodcast #PolyglotLife #LearnLanguages #Remastered #ClassicEpisode #PolishSeasons #PolishNature #TravelPolish #PolishCulture #PolishLessons #Episode600 #Milestone600 #TeatroDeIdiomas #RoyCoughlan #PodFather #PodcastCoach #Top1Percent

View Details

Welcome to the New Year - Witamy w Nowym Roku

How was your New Years Party - Jak minęła impreza noworoczna

Everything was good - Wszystko było dobrze

How was you New Years party? - Jak ci minęło przyjęcie noworoczne?

I was at home with my son because you had a party - Byłem w domu z moim synem, ponieważ miałeś imprezę

New Years Resolutions - Postanowienia noworoczne

What are your New Years Resolutions? - Jakie są twoje postanowienia noworoczne?

for me I always have a book that I write a list of goals that I want to do for the year - dla mnie zawsze mam książkę, w której piszę listę celów, które chcę zrobić na ten rok

What is your goal No.1? - Jaki jest twój cel nr 1?

Read 50 Books - Przeczytaj 50 książek

No.2 to do 26 online courses - Nr 2 na 26 kursów online

To do something like Polish online? - zrobić coś takiego jak polski online?

No something interesting - Nic ciekawego

Something that gives me energy and not take it - Coś, co daje mi energię i jej nie biorę

No. 3 I don't know. I do not have my list with me - Nr 3 nie wiem. Nie mam przy sobie mojej listy

Go to another country that I have never been to - Idź do innego kraju, w którym nigdy nie byłem

Cook 5 new dishes - Gotuj 5 nowych potraw

and you Kamila, what is your New Years Resolutions? - a wy Kamila, jakie są wasze postanowienia noworoczne?

My plan for the new year is less work / more rest - Mój plan na nowy rok to mniej pracy / więcej odpoczynku

To do more sport especially Yoga - Uprawiać więcej sportu, zwłaszcza jogę

I plan to do a Yoga course for being a Yoga instructor - Planuję zrobić kurs jogi jako instruktor jogi

More walking - Więcej chodzenia

More time in Nature - Więcej czasu w naturze

The most important plan - Najważniejszy plan

What are our students plans for the new year? - Jakie są plany naszych studentów na nowy rok?

Maybe less TV - Może mniej telewizji

Maybe less work - Może mniej pracy

Maybe to relax more - Może bardziej zrelaksować się

Maybe more sport - Może więcej sportu

Maybe less fast food - Może mniej fast foodów

Earn more money - Zarób więcej pieniędzy

Don't smoke cigarettes - Nie pal papierosów

or don't drink alcohol - lub nie pij alkoholu

or don't drink coffee - lub nie pij kawy

or don't take drugs - lub nie bierz narkotyków

So write what are your plans for the new year - Napisz więc, jakie masz plany na nowy rok

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

✦ Instagram: https://www.instagram.com/learnpolishpodcast/

Teatro de idiomas

Polish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.instagram.com/teatrodeidiomas/

https://teatrodeidiomas.pl/pl/

I have just launched my PodFather Podcast Coach Community https://www.skool.com/podfather/about

Start your own SKOOl Academy https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

Do you want to unlock your potential?

https://www.skool.com/brainfitness/about

LearnPolish #PolishPodcast #LearnPolishPodcast #PolishLanguage #PolskiJęzyk #PoPolsku #PolishForForeigners #NewYearsResolutions #PostanowieniaNoworoczne #NewYearInPolish #PolishNewYear #PolishVocabulary #ConversationalPolish #EverydayPolish #PolishPhrases #LanguageLearning #LanguagePodcast #PolyglotLife #LearnLanguages #Remastered #ClassicEpisode #NewYearNewYou #GoalsInPolish #PolishMotivation #PolishTraditions #PolishCulture #PolishLessons #TeatroDeIdiomas #RoyCoughlan #PodFather #PodcastCoach #Episode598 #Top1Percent

View Details

In this Episode you will learn: - W tym odcinku nauczysz się:

Warmly welcome - Serdecznie witamy

How are you - Jak się masz

I'm good and you - dobrze, a ty

What will we be talking about today - O czym dzisiaj będziemy rozmawiać

Christmas - Boże Narodzenie

Merry Christmas - Wesołych Świąt

Roy you don't have a Christmas tree - Roy, nie masz choinki

Better outside - Lepiej na zewnątrz

Decorate the tree - Udekoruj drzewo

In Poland people decorate trees - W Polsce ludzie dekorują drzewa

Angel - Anioł

On the top is a star - Na górze jest gwiazda

Christmas balls - Bombki choinkowe

Christmas lights - oświetlenie świąteczne

I have two Christmas trees, one in the saloon and the other in my sons room - Mam dwie choinki, jedną w salonie i drugą w pokoju moich synów

Students do you have a Christmas tree at home? - Studenci, czy macie w domu choinkę?

Happy New Year and Merry Christmas - Szczęśliwego Nowego Roku i Wesołych Świąt

We cook a lot - Dużo gotujemy

In Poland people generally cook dumplings - W Polsce ludzie zazwyczaj gotują pierogi

Turkey - indyk

Roast Potatoes - Pieczone ziemniaki

What is your main dish - Jakie jest twoje główne danie?

Mushroom soup with noodles - Zupa grzybowa z makaronem

Cabbage with peas - Kapusta Z Groszkiem

Carp fish - Karp

Presents - Przedstawia

Presents under the Christmas tree - Prezenty pod choinką

Polish tradition - Polska tradycja

Santa clause - Święty Mikołaj

Thank you for listening for the whole year - Dziękujemy za słuchanie przez cały rok

We will be back next year - Wrócimy w przyszłym roku

Merry Christmas and Happy New Year - Wesołych Świąt i Szczęśliwego Nowego Roku

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

✦ Instagram: https://www.instagram.com/learnpolishpodcast/

Teatro de idiomas

Polish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.instagram.com/teatrodeidiomas/

https://teatrodeidiomas.pl/pl/

I have just launched my PodFather Podcast Coach Community https://www.skool.com/podfather/about

Start your own SKOOl Academy https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

Do you want to unlock your potential?

https://www.skool.com/brainfitness/about

LearnPolish #PolishPodcast #LearnPolishPodcast #PolishLanguage #PolskiJęzyk #PoPolsku #PolishForForeigners #MerryChristmas #WesołychŚwiąt #ChristmasInPolish #PolishChristmas #PolishVocabulary #ConversationalPolish #EverydayPolish #PolishPhrases #LanguageLearning #LanguagePodcast #PolyglotLife #LearnLanguages #Remastered #ClassicEpisode #PolishTraditions #PolishCulture #ChristmasTraditions #PolishHolidays #PolishLessons #TeatroDeIdiomas #RoyCoughlan #PodFather #PodcastCoach #Episode597 #Top1Percent

View Details

In this Episode you will learn:

Hi / Bye - Cześć, or bye can be paToday we will talk about sport - Dzisiaj porozmawiamy o sporcieDo you like sport - Lubisz sportTo do sport - Uprawiać sportHow often do you play sport - Jak często uprawiasz sportOnce a week - Raz w tygodniuTwice a week - Dwa razy w tygodniu

What type of sport - Jaki rodzaj sportuI

play squash - Gram w squasha

When the weather is good I cycle - Przy dobrej pogodzie jeżdżę na rowerze

What else - Co jeszcze

Do you swim - PływaszI

prefer to swim at the beach - Wolę pływać na plaży

Ocean - Ocean

I like to swim in the ocean - Lubię pływać w oceanieIn

the swimming pool - W basenie

When I was young - Kiedy byłem młody

Lots of swimming pools have chlorine and its not good for your skin - Wiele basenów ma chlor i nie jest dobry dla twojej skóry

What types of sport do you know - Jakie rodzaje sportu znasz?

Martial Arts - Sztuki walki

Maybe football - Może futbol

Basketball - Koszykówka

Volleyball / Tennis / Golf - Siatkówka / Tenis / Golf

Badminton / Skiing / Ice Skating - Badminton / Narciarstwo / Łyżwiarstwo

Rugby - Rugby

Scuba Diving - Nurkowanie z akwalungiem

Sky Diving - Spadochroniarstwo

Extreme Sports - Sporty ekstremalne

Parachute - Spadochron

What sport do you like - Jaki sport lubisz

I do not like to watch sport, I prefer to play - Nie lubię oglądać sportu, wolę grać

Squash / Tennis / Martial Arts / Swimming - Squash / Tenis / Sztuki walki / PływanieI like to run - lubię biegać

Cycle - Cykl

Do Yoga, its very good for your health and body - Uprawiaj jogę, która jest bardzo dobra dla zdrowia i ciała

I like to play football with my son - Lubię grać w piłkę nożną z moim synem

We were in the shop and he asked me to buy a basketball - Byliśmy w sklepie, a on poprosił mnie o zakup koszykówki

and when you were young - a kiedy byłeś młody

Boxing - Boks

Its good for your head - To dobrze dla twojej głowy

Students - What sports do you like best? - Studenci - Jakie sporty lubisz najbardziej?

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

✦ Instagram: https://www.instagram.com/learnpolishpodcast/

Teatro de idiomas

Polish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.instagram.com/teatrodeidiomas/

https://teatrodeidiomas.pl/pl/

I have just launched my PodFather Podcast Coach Community https://www.skool.com/podfather/about

Start your own SKOOl Academy https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

Do you want to unlock your potential?

https://www.skool.com/brainfitness/about

LearnPolish #PolishPodcast #LearnPolishPodcast #PolishLanguage #PolskiJęzyk #PoPolsku #PolishForForeigners #Sport #SportPoPolsku #SportsInPolish #PolishVocabulary #ConversationalPolish #EverydayPolish #PolishPhrases #LanguageLearning #LanguagePodcast #PolyglotLife #LearnLanguages #Remastered #ClassicEpisode #PolishSports #PolishLessons #PolishForBeginners #PolishCulture #TeatroDeIdiomas #RoyCoughlan #PodFather #PodcastCoach #Episode596 #Top1Percent

View Details

In this weeks Episode we discuss parts of the body:

dzień dobry - Good day

Jak się masz - How are you

bardzo dobrze - very good

dziś dużo intensywnej pracy, ale bardzo przyjemna - today a lot of intensive work but very nice

a ty - and you

także dobre - also good

ponieważ masz lekcję polskiego - because you have a Polish lesson

i lubisz się uczyć - and you like to learn

oczywiście - of course

Twoją pasją i hobby jest nauka polskiego - your passion and you hobby is to learn polish

oczywiście - of course

Zobacz, znam cię - See I know you

Dzisiaj poznamy części ciała - Today we will learn parts of the body

Ty wiesz wszystko - You know everything

Części samochodu / komputera - Parts of the car / computer

Mam trudny dzień - I have a difficult day

Co to jest - What is that

Włosy / głowa / czoło / brwi - Hair / head / forehead / eyebrows

powieki / rzęsy / policzki / nos - eyelids / eye lashes / cheecks / nose

Wargi / podbródek / szyja / tył głowy - Lips / chin / neck / back of the head

zęby / białe zęby / żółte zęby / zdrowe zęby / złamane zęby - teeth / white teeth / yellow teeth / healthy teeth / broken teeth

Ramię / ręka / palce - Arm / hand / fingers

Ile palców - How many fingers

Każdy palec ma imię - Every finger has a name

Kciuk, a następnie palec wskazujący, palec środkowy, palec serdeczny i mały palec lub szpilka - Thumb, followed by index finger, middle finger, ring finger, and little finger or pinkie

ucho / uszy - ear / ears

Brzuch / noga / kolano / stopa - Stomach / leg / knee / foot

Twarz - face

Mam długie blond włosy, brązowe brwi, niebieskie oczy, czerwone usta i duży brzuch - I have long blond hair, brown eyebrows , blue eyes, red lips and a big belly

a ty - and you

Mam krótkie srebrne włosy - I have short silver hair

Mam brązowe brwi - I have brown eyebrows

Mam niebieskie / zielone oczy - I have blue / green eyes

piękne zdrowe zęby - beautiful healthy teeth

mały brzuch - small stomach

Twoje plecy - Your back

bezdomny jest kulturą - bum is cultural

tyłek nie jest kulturalny - ass is not cultural

policzki - cheecks

do usłyszenia - hear you later

trochę - a little

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

✦ Instagram: https://www.instagram.com/learnpolishpodcast/

Teatro de idiomas

Polish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.instagram.com/teatrodeidiomas/

https://teatrodeidiomas.pl/pl/

I have just launched my PodFather Podcast Coach Community https://www.skool.com/podfather/about

Start your own SKOOl Academy https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

Do you want to unlock your potential?

https://www.skool.com/brainfitness/about

LearnPolish #PolishPodcast #LearnPolishPodcast #PolishLanguage #PolskiJęzyk #PoPolsku #PolishForForeigners #PartsOfTheBody #CzęściCiała #BodyPartsInPolish #PolishVocabulary #ConversationalPolish #EverydayPolish #PolishPhrases #LanguageLearning #LanguagePodcast #PolyglotLife #LearnLanguages #Remastered #ClassicEpisode #PolishAnatomy #PolishLessons #PolishForBeginners #PolishCulture #TeatroDeIdiomas #RoyCoughlan #PodFather #PodcastCoach #Episode595 #Top1Percent

View Details

We will learn polish - Nauczymy się polskiego

Of course - Oczywiście

Today we will be learning the plan for tomorrow - Dzisiaj poznamy plan na jutro

Please repeat - Proszę powtórzyć

I will be - będę

You will be - Będziesz

He / She will be - On / Ona będzie

It will be - To będzie

We will be - Będziemy

They will be - Oni / One będą

I will be reading - Będę czytać

I will be eating - Będę jeść

I will be writing - Będę pisać

I will sleep - będę spał

I will swim - Będę pływał

I will learn - Nauczę się

Do you understand grammar - Czy rozumiesz gramatykę?

Now a question for you - Teraz pytanie do ciebie

What else - Co jeszcze

I will be running in the park - Będę biegał w parku

I will be playing squash - Będę grał w squasha

I will be reading a book - Będę czytać książkę

I will be with my son and play board games - Będę z synem i będę grać w gry planszowe

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

✦ Instagram: https://www.instagram.com/learnpolishpodcast/

Teatro de idiomas

Polish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.instagram.com/teatrodeidiomas/

https://teatrodeidiomas.pl/pl/

I have just launched my PodFather Podcast Coach Community https://www.skool.com/podfather/about

Start your own SKOOl Academy https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

Do you want to unlock your potential?

https://www.skool.com/brainfitness/about

LearnPolish #PolishPodcast #LearnPolishPodcast #PolishLanguage #PolskiJęzyk #PoPolsku #PolishForForeigners #PlanNaJutro #PlanForTomorrow #PolishVocabulary #ConversationalPolish #EverydayPolish #PolishPhrases #LanguageLearning #LanguagePodcast #PolyglotLife #LearnLanguages #Remastered #ClassicEpisode #PolishPlanning #DailyRoutinePolish #PolishLife #PolishCulture #PolishLessons #Teatro de Idiomas #RoyCoughlan #PodFather #PodcastCoach #Episode594 #Top1Percent

View Details

In today's lesson we discussed the following:

I feel very good today - Czuję się bardzo dobrze dzisiaj

why - dlaczego

Because today I did Yoga & Meditation and I feel fantastic - Ponieważ dzisiaj ćwiczyłem jogę i medytację i czuję się fantastycznie

Do you understand - Czy rozumiesz

Railway Station - Stacja kolejowa

Please repeat - Proszę powtórzyć

I am going to the railway station - Idę na dworzec kolejowy

Please take me to the railway station - Proszę, zabierz mnie na dworzec kolejowy

I am at the railway station - Jestem na stacji kolejowej

We must buy a ticket - Musimy kupić bilet

We go to the cash desk - Idziemy do kasy

I would like a ticket - Chciałbym bilet

What type of ticket - Jaki rodzaj biletu

A ticket can be normal or with discount - Bilet może być normalny lub ze zniżką

One normal ticket to Kracow/ Warsaw / Lodz / Gdansk - Jeden normalny bilet do Krakowa / Warszawy / Łodzi / Gdańska

What class - Jaka klasa

1st class / 2nd Class / 3rd Class - Pierwsza klasa / druga klasa / trzecia klasa

We can practice - Możemy ćwiczyć

I am the cashier and you are the customer - Jestem kasjerem, a ty klientem

A ticket to Warsaw please - Poproszę bilet do Warszawy

What type of ticket - Jaki rodzaj biletu

What time - Jaki czas

What time is the next train - O której jest następny pociąg

The next train is 1pm - Następny pociąg to 13.00

58zl please - 58zł proszę

I thought it would be cheaper - Myślałem, że będzie taniej

Second Class 48zl - Druga klasa 48zl

Third class 30zl - Trzecia klasa 30zł

I will be with the animals - Będę ze zwierzętami

Will you pay by cash or credit card - Czy zapłacisz gotówką czy kartą kredytową?

Normal train / Fast train / Express train / Intercity - Pociąg normalny / pociąg szybki / pociąg ekspresowy / intercity

It must be that train - To musi być ten pociąg

How long will the train take - Jak długo potrwa pociąg

one hour fifteen minutes - godzina piętnaście minut

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

✦ Instagram: https://www.instagram.com/learnpolishpodcast/

Teatro de idiomas

Polish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.instagram.com/teatrodeidiomas/

https://teatrodeidiomas.pl/pl/

I have just launched my PodFather Podcast Coach Community https://www.skool.com/podfather/about

Start your own SKOOl Academy https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

Do you want to unlock your potential?

https://www.skool.com/brainfitness/about

LearnPolish #PolishPodcast #LearnPolishPodcast #PolishLanguage #PolskiJęzyk #PoPolsku #PolishForForeigners #RailwayStation #StacjaKolejowa #TrainInPolish #PolishTravel #PolishVocabulary #ConversationalPolish #EverydayPolish #PolishPhrases #LanguageLearning #LanguagePodcast #PolyglotLife #LearnLanguages #Remastered #ClassicEpisode #TravelPolish #PolishTransport #PolishForTravellers #PolishCulture #PolishLessons #TeatroDeIdiomas #RoyCoughlan #PodFather #PodcastCoach #Episode593 #Top1Percent

View Details

In this episode, Ania and Roy dive into a topic inspired by a Sunday cooking session — meat, protein, and the future of food. They discuss vegetarian vs vegan diets, whether you can live well without meat, and tackle the big question: would you eat GMO or 3D-printed meat? A fun, real conversation packed with everyday Polish vocabulary around food, health, and technology.

🇵🇱 Perfect for: Intermediate Polish learners who want natural, conversational Polish on modern topics.

⏱️ TIMESTAMPS

00:00 – Welcome & intro to LearnPolishPodcast.com

01:15 – Small talk: Sunday afternoon, the weather in Łódź

02:30 – Topic intro: Ania gets inspired while cooking

03:10 – Vocabulary: Sources of protein in Polish (białko, mięso, jogurt, jajka...)

05:00 – How often does Roy eat meat? His weekly routine

06:20 – Could you live without meat? Roy's 16-day retreat in Croatia

08:00 – Vegetarian vs vegan diets — what's the difference in Polish?

10:30 – Are plant-based diets healthy? Both sides of the debate

13:00 – The future of meat: GMO & genetically modified food

15:30 – 3D-printed steak — Roy saw it in the USA. Does it taste the same?

18:00 – Final thoughts: natural food vs technology

19:30 – Listener question & call to action

20:30 – Outro: Roy's links, Ania's lessons, upcoming episodes

🤝 JOIN OUR LEARN POLISH PODCAST COMMUNITY

🌐 Website: https://www.learnpolishpodcast.com/

🎙️ Podbean: https://learnpolish.podbean.com/

▶️ YouTube: https://www.youtube.com/@learnpolish

📘 Facebook: https://www.facebook.com/learnpolishpodcast/

🎵 TikTok: https://www.tiktok.com/@roycoughlanpodcaster

📸 Instagram: https://www.instagram.com/learnpolishpodcast/

🎓 LEARN POLISH WITH ANIA — Teatro de Idiomas

Hi, I'm Ania, founder of Teatro de Idiomas! Learning Polish doesn't have to be boring — with us it's fun, inspiring, and exciting. We teach through Spanish, English, or Russian, so you learn Polish in a language you're already comfortable with.

📸 Instagram: https://www.instagram.com/teatrodeidiomas/

🌐 Website: https://teatrodeidiomas.pl/pl/

🎙️ ALL ABOUT ROY

🚀 PodFather Podcast Coach Community: https://www.skool.com/podfather/about 🧠 Brain Fitness & Unlock Your Potential: https://www.skool.com/brainfitness/about 🌐 Roy's Hub (Brain Gym & Virtual Assistants): https://roycoughlan.com/

🏫 Start Your Own Skool Academy: https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

LearnPolish #PolishPodcast #LearnPolishPodcast #PolishLanguage #PolskiJęzyk #PoPolsku #PolishForForeigners #GMOMeat #3DPrintedFood #FutureOfFood #VeganDiet #WegetarianizWegaństwo #PolishVocabulary #ConversationalPolish #LanguageLearning #PolyglotCommunity #Teatro de Idiomas #RoyCoughlan #PodFather #PodcastCoach #LearnLanguages #FoodInPolish #HealthyEating #MeatFree #PlantBased #PolishCulture #Episode592

View Details

In today's episode we discussed:

How do you feel - Jak się czujesz

Good and you - Dobrze, a ty

What is the topic today - Jaki jest dziś temat

There is a very popular phrase - Istnieje bardzo popularne zdanie -

Excuse me where is - Przepraszam, gdzie jest

Where is the Hotel Ibis - Gdzie jest hotel Ibis

Where is the Railway station - Gdzie jest dworzec kolejowy

Where is the Hospital - Gdzie jest szpital

Where is the closest Post Office - Gdzie jest najbliższy urząd pocztowy

Please repeat - Proszę powtórzyć

Where is the Bus Station - Gdzie jest przystanek autobusowy

How can I get to the centre - Jak mogę dostać się do centrum

Take a Taxi - Wziąć taksówkę

How can I get to the Museum - Jak mogę dostać się do muzeum

I'm lost Man / Woman - Jestem zagubiony Mężczyzna / Kobieta

Where is the Pharmacy - Gdzie jest apteka

Please go straight - Proszę idź prosto

or please turn left - lub proszę skręcić w lewo -

Please turn right - Proszę skręcić w prawo

Where is the hotel Hilton - Gdzie jest hotel Hilton

Around 10 minutes on foot - Około 10 minut na piechotę

Please go straight, later turn right and straight again - Proszę iść prosto, potem skręcić w prawo i znowu prosto

I'm not from here - Nie jestem stąd

Where is the Museum - Gdzie jest Muzeum

We have a few museums in our city - W naszym mieście mamy kilka muzeów

Go straight to the end of the street and then turn right - Idź prosto na koniec ulicy, a następnie skręć w prawo

The museum is there - Muzeum jest tam

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

✦ Instagram: https://www.instagram.com/learnpolishpodcast/

Teatro de idiomas

Polish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.instagram.com/teatrodeidiomas/

https://teatrodeidiomas.pl/pl/

I have just launched my PodFather Podcast Coach Community https://www.skool.com/podfather/about

Start your own SKOOl Academy https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

Do you want to unlock your potential?

https://www.skool.com/brainfitness/about

LearnPolish #PolishLanguage #ZwierzetaDomowe #Pets #PolishPodcast #Pies #Kot #Animals #LearnPolishOnline #PolishVocabulary #LanguageLearning #PolishCulture #Dog #Cat #PetLovers #Shorts #LanguageShorts #Polyglot #StudyPolish #PolishForBeginners

At the end of the street - Na końcu ulicy

View Details

Today is a super day - Dzisiaj jest super dzień

Why - Dlaczego

Today is Monday - Dziś jest poniedziałek

Do you know the days of the week? - Czy znasz dni tygodnia?

Monday - poniedziałek

Tuesday - wtorek

Wednesday - środa

Thursday - czwartek

Friday - piątek

Saturday - sobota

Sunday - niedziela

Roy what do you do on Monday - Roy, co robisz w poniedziałek

On Monday I study - W poniedziałek studiuję

Polish language /Economics / Medicine - Język polski / ekonomia / medycyna

On Tuesday I go to the Gym - We wtorek idę na siłownię

On Wednesday I go to a Toastmasters meeting - W środę idę na spotkanie Toastmasters

On Thursday I work - W czwartek pracuję

On Friday I am with my son and we play - W piątek jestem z synem i gramy

I go to the park on Saturday - Idę do parku w sobotę

Lazy day on Sunday - Leniwy dzień w niedzielę

I do nothing - ja nic nie robię

Kamila what do you do on Monday - Kamila, co robisz w poniedziałek

I have Polish lessons on Monday - Mam lekcje polskiego w poniedziałek

I have yoga lessons on Tuesday - Mam lekcje jogi we wtorek

I meditate on Wednesday(http://meditationpodcast.org/) - Medytuję w środę

On Thursday I walk in the park - W czwartek chodzę po parku

On Friday I listen to relaxing music - W piątek słucham relaksującej muzyki

On Saturday I shop in the supermarket - W sobotę robię zakupy w supermarkecie

I rest on Sunday - Odpoczywam w niedzielę

And what do you do on Sunday? - A co robisz w niedzielę?

We wait for your comments - Czekamy na Twoje komentarze

Thank you very much - Dziękuję Ci bardzo

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

✦ Instagram: https://www.instagram.com/learnpolishpodcast/

Teatro de idiomas

Polish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.instagram.com/teatrodeidiomas/

https://teatrodeidiomas.pl/pl/

I have just launched my PodFather Podcast Coach Community https://www.skool.com/podfather/about

Start your own SKOOl Academy https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

Do you want to unlock your potential?

https://www.skool.com/brainfitness/about

LearnPolish #PolishLanguage #ZwierzetaDomowe #Pets #PolishPodcast #Pies #Kot #Animals #LearnPolishOnline #PolishVocabulary #LanguageLearning #PolishCulture #Dog #Cat #PetLovers #Shorts #LanguageShorts #Polyglot #StudyPolish #PolishForBeginners

View Details

I am sitting in your school - Siedzę w twojej szkole

I am drinking coffee without caffeine - Piję kawę bez kofeiny

Today we continue the topic with food - Dziś kontynuujemy ten temat jedzeniem

Today will be vegetables - Dzisiaj będą warzywa

One Vegetable - Jedno warzywo

Vegetables - warzywa

Do you like vegetables - Czy lubisz warzywa

Children don't like vegetables - Dzieci nie lubią warzyw

What vegetables do you know - Jakie znasz warzywa?

Cauliflower - kalafior

Broccoli - brokuły

Tomato - Pomidor

What else - Co jeszcze

Potato - Ziemniak

Carrot - Marchewka

Parsnip - Pasternak

Garlic - czosnek

Onion - Cebula

Sharlots - Sharlots

Green Onions - Zielone cebule

Cucumber - Ogórek

Peppers - Red / Green / Yelow : Papryka - Czerwona / Zielona / Żółta

Beans - fasolki

Peas / Green peas - Groch / zielony groszek

Lettuce - Sałata

Salad - Sałatka

Very good - Bardzo dobre

What vegetable do you like - Jakie warzywa lubisz

Carrot - Marchewka

Only carrot - Tylko marchewka

Anything else - Coś jeszcze

Rocket - Rukola

I like lentils - Lubię soczewicę

I really like sweet potatoes - Naprawdę lubię słodkie ziemniaki

Big sweet potatoes - Duże słodkie ziemniaki

How do you cook - Jak gotujesz

I do not cook I bake - Nie gotuję, pieczę

Cut them like chips - Pokrój je jak frytki

Generally vegetables are very healthy - Ogólnie warzywa są bardzo zdrowe

My son really likes fresh green cucumber - Mój syn naprawdę lubi świeży zielony ogórek

Vegetables have lots of vitamins - Warzywa mają dużo witamin

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

✦ Instagram: https://www.instagram.com/learnpolishpodcast/

Teatro de idiomas

Polish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.instagram.com/teatrodeidiomas/

https://teatrodeidiomas.pl/pl/

I have just launched my PodFather Podcast Coach Community https://www.skool.com/podfather/about

Start your own SKOOl Academy https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

Do you want to unlock your potential?

https://www.skool.com/brainfitness/about

LearnPolish #PolishLanguage #ZwierzetaDomowe #Pets #PolishPodcast #Pies #Kot #Animals #LearnPolishOnline #PolishVocabulary #LanguageLearning #PolishCulture #Dog #Cat #PetLovers #Shorts #LanguageShorts #Polyglot #StudyPolish #PolishForBeginners

Tasty Topic - Smaczny temat

View Details

O czym dzisiaj będziemy rozmawiać - What will we be talking about today

Dzisiaj porozmawiamy o owocach - Today we will talk about fruit

Jestem wegetarianinem i bardzo lubię owoce - I am a vegetarian and I like fruit very much

Czy rozumiesz - Do you understand

Jakie owoce znasz po polsku? - What fruit do you know in Polish

Jabłko - Apple

Pomarańczowy - Orange

Truskawka - Strawberry

Malina - Rasberry

Banan - Bananna

Winogrona - Grapes

Brzoskwinia - Peach

Gruszka - Pear

Ananas - Pinapple

Arbus - Water Mellon

Jagody - Berries

Jaki owoc lubisz - What fruit do you like

Avacado - Avacado

Kiwi - kiwi

Cytrynowy - Lemmon

Limonka - Lime

Co lubisz - What do you like

Lubisz wszystko - You like everything

Wolę się zmieniać, ponieważ nie lubię codziennie jeść tych samych owoców - I prefer to change as I don't like to eat the same fruit everyday

Moim ulubionym owocem jest - My favourite fruit is

Czasami - Sometimes

Proszę powtórzyć - Please repeat

Owoce / Owoce - Fruit / Fruits

Mango - Mango

Lubię koktajl z mango - I like a mango smoothie

Jagody - Blueberries

Dziękuję Cie - Thank you

Do widzenia - Good bye

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

✦ Instagram: https://www.instagram.com/learnpolishpodcast/

Teatro de idiomas

Polish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.instagram.com/teatrodeidiomas/

https://teatrodeidiomas.pl/pl/

I have just launched my PodFather Podcast Coach Community https://www.skool.com/podfather/about

Start your own SKOOl Academy https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

Do you want to unlock your potential?

https://www.skool.com/brainfitness/about

LearnPolish #PolishLanguage #ZwierzetaDomowe #Pets #PolishPodcast #Pies #Kot #Animals #LearnPolishOnline #PolishVocabulary #LanguageLearning #PolishCulture #Dog #Cat #PetLovers #Shorts #LanguageShorts #Polyglot #StudyPolish #PolishForBeginners

View Details

jestem głodny - I am hungry

Idziemy do sklepu - We are going to the shop

idę do sklepu - I am going to the shop

Czy lubisz zakupy? - Do you like shopping?

Lubię gotować - I like to cook

Chleb - Bread

Bułka - Bread Roll

masło - Butter

Herbata - Tea

Kawa - Coffee

Woda mineralna - Mineral Water

Gaz lub bez gazu - Gas or without gas

Ser - Cheese

Jogurt - Yogurt

Kg Pomidorów - Kg of Tomatoes

Kg ziemniaków - Kg of Potatoes

Kg bananów - Kg of Bananas

Kg ogórka - Kg of Cucumber

Kg cukru - Kg of Sugar

Kg jabłek - Kg of Apples

Kg pomarańczy - Kg of Oranges

Idziemy do sklepu - We go to the shop

Dzień dobry - Good morning

Proszę - Please

Co byś chciał - What would you like

Coś jeszcze - Anything else

Nie, dziękuję - No Thanks

To wszystko - Thats all

Czy mogę płacić kartą - Can I pay by card

Oczywiście - Of course

Do widzenia - Good bye

Miłego dnia - Have a good day

Nawzajem - Same to you

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

✦ Instagram: https://www.instagram.com/learnpolishpodcast/

Teatro de idiomas

Polish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.instagram.com/teatrodeidiomas/

https://teatrodeidiomas.pl/pl/

I have just launched my PodFather Podcast Coach Community https://www.skool.com/podfather/about

Start your own SKOOl Academy https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

Do you want to unlock your potential?

https://www.skool.com/brainfitness/about

LearnPolish #PolishLanguage #ZwierzetaDomowe #Pets #PolishPodcast #Pies #Kot #Animals #LearnPolishOnline #PolishVocabulary #LanguageLearning #PolishCulture #Dog #Cat #PetLovers #Shorts #LanguageShorts #Polyglot #StudyPolish #PolishForBeginners

View Details

What time is it - Która godzina

1:00 a.m. - 1:00 (pierwsza/pierwsza rano)

2:00 a.m. - 2:00 (druga/druga rano)

3:00 a.m. - 3:00 (trzecia/trzecia rano)

4:00 a.m. - 4:00 (czwarta/czwarta rano)

5:00 a.m. - 5:00 (piąta/piąta rano)

6:00 a.m. - 6:00 (szósta/szósta rano)

7:00 a.m. - 7:00 (siódma/siódma rano)

8:00 a.m. - 8:00 (ósma/ósma rano)

9:00 a.m. - 9:00 (dziewiąta/dziewiąta rano)

10:00 a.m. - 10:00 (dziesiąta/dziesiąta rano)

11:00 a.m. - 11:00 (jedenasta/jedenasta rano)

12:00 p.m. - 12:00 (dwunasta/dwunasta w południe)

1:00 p.m. - 13:00 (trzynasta/pierwsza popołudniu)

2:00 p.m. - 14:00 (czternasta/druga popołudniu)

3:00 p.m. - 15:00 (piętnasta/trzecia popołudniu)

4:00 p.m. - 16:00 (szesnasta/czwarta popołudniu)

5:00 p.m. - 17:00 (siedemnasta/piąta popołudniu)

6:00 p.m. - 18:00 (osiemnasta/szósta popołudniu)

7:00 p.m. - 19:00 (dziewiętnasta/siódma wieczorem)

8:00 p.m. - 20:00 (dwudziesta/ósma wieczorem)

9:00 p.m. - 21:00 (dwudziesta pierwsza/dziewiąta wieczorem)

10:00 p.m. - 22:00 (dwudziesta druga/dziesiąta wieczorem)

11:00 p.m. - 23:00 (dwudziesta trzecia/jedenasta wieczorem)

12:00 a.m. - 24:00 (dwudziesta czwarta/północ)

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

✦ Instagram: https://www.instagram.com/learnpolishpodcast/

Teatro de idiomas

Polish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.instagram.com/teatrodeidiomas/

https://teatrodeidiomas.pl/pl/

I have just launched my PodFather Podcast Coach Community https://www.skool.com/podfather/about

Start your own SKOOl Academy https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

Do you want to unlock your potential?

https://www.skool.com/brainfitness/about

LearnPolish #PolishLanguage #ZwierzetaDomowe #Pets #PolishPodcast #Pies #Kot #Animals #LearnPolishOnline #PolishVocabulary #LanguageLearning #PolishCulture #Dog #Cat #PetLovers #Shorts #LanguageShorts #Polyglot #StudyPolish #PolishForBeginners

View Details

What It's AboutThis episode teaches Polish vocabulary for common pets and animals. Ania covers how to talk about your furry (and scaly) friends in Polish—from dogs and cats to more exotic companions. The episode includes practical phrases for describing your pet, asking about others' animals, and understanding Polish pet culture.Key Polish Words & Phrases* Pies – dog * Kot – cat * Zwierzę domowe – pet (domestic animal) * Mam psa/kota – I have a dog/cat * Jak masz na imię? – What's your name? (for pets too!)

Cultural NotePoles love their pets! Dogs are especially popular in cities, and you'll often see them in cafes and on public transport. The phrase "zwierzę domowe" literally means "domestic animal"—Poles don't use a single word like "pet," they specify "house animal." 🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

✦ Instagram: https://www.instagram.com/learnpolishpodcast/

Teatro de idiomas

Polish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.instagram.com/teatrodeidiomas/

https://teatrodeidiomas.pl/pl/

I have just launched my PodFather Podcast Coach Community https://www.skool.com/podfather/about

Start your own SKOOl Academy https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

Do you want to unlock your potential?

https://www.skool.com/brainfitness/about

LearnPolish #PolishLanguage #ZwierzetaDomowe #Pets #PolishPodcast #Pies #Kot #Animals #LearnPolishOnline #PolishVocabulary #LanguageLearning #PolishCulture #Dog #Cat #PetLovers #Shorts #LanguageShorts #Polyglot #StudyPolish #PolishForBeginners

View Details

Overwhelm – Przytłoczenie"Przytłoczenie" means "overwhelm," and in this mindful micro-lesson you'll say it like you're finally admitting you need to pause—and that's okay.First you hear the word at native speed, then slowed down so you can master the tricky "przy" cluster and the soft "tłoczenie." We drop it into three calming sentences:– "Czuję się przytłoczony." (I feel overwhelmed.) – "Potrzebuję przerwy." (I need a break.) – "To za dużo dla mnie." (It's too much for me.)Repeat-along track included—perfect while you step away, breathe, or reset your priorities.Challenge: Tell us in the comments what YOU do when overwhelmed—reply in Polish and let's support each other EnglishPolishPronunciation Guideoverwhelmprzytłoczeniepshi-twoh-cheh-nyehI feel overwhelmedczuję się przytłoczony/achoo-yeh sheh pshi-twoh-choh-ni / pshi-twoh-choh-nahtoo muchza dużozah doo-zhohI can't handle itnie daję radynyeh dah-yeh rah-diI need a breakpotrzebuję przerwypot-sheh-boo-yeh psheh-rvistressstresstresanxietyniepokój / lęknyeh-poh-koo-y / lengkpressurepresjapreh-syahtiredzmęczony / zmęczonazmeng-choh-ni / zmeng-choh-nahexhaustedwyczerpany / wyczerpanavi-cher-pah-ni / vi-cher-pah-nahrestodpoczynekohd-poh-chi-nehkpausepauza / przerwapow-zah / psheh-rvahstopstop / przestaństop / psheh-stahnbreatheoddychajoh-di-hahycalm downuspokój sięoo-spoh-koo-y shehrelaxrelaksować sięreh-lahk-soh-vahch shehslow downzwolnićzvol-neechtake it easyspokojniespoh-koy-nyehone step at a timekrok po krokukrok poh kroh-kooit's okayw porządkuv por-yon-dkoodon't worrynie martw sięnyeh martf shehI can do itdam radędahm rah-dehstrongsilny / silnaseel-ni / seel-nahweaksłaby / słabaswah-bi / swah-bahhelppomocpoh-motssupportwsparcievspar-chehtalkrozmowarohz-moh-vahlistensłuchaćswoo-hahchunderstandrozumiećroh-zoo-myehchprioritypriorytetpryoh-ri-tehtlimitlimit / granicalee-meet / grah-nee-tsahboundarygranicagrah-nee-tsahnonienyehyestaktahkenoughdość / wystarczającodohshch / vi-star-tsah-yoh-kohmorewięcejvyen-chehylessmniejmnyehbalancerównowagaroov-noh-vah-gahpeacespokójspoh-koo-yquietciszachee-shahspaceprzestrzeńpsheh-strentimeczaschahsnowterazteh-rahslaterpóźniejpoozh-nyehytomorrowjutroyoo-trohtodaydziśdzeeshmeja / mnieyah / mnyehyouty / ciebieti / cheh-byehusnasnahstogetherrazemrah-zemalonesam / samasahm / sah-mah🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

✦ Instagram: https://www.instagram.com/learnpolishpodcast/

Teatro de idiomas

Polish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.instagram.com/teatrodeidiomas/

https://teatrodeidiomas.pl/pl/

I have just launched my PodFather Podcast Coach Community https://www.skool.com/podfather/about

Start your own SKOOl Academy https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

Do you want to unlock your potential?

https://www.skool.com/brainfitness/about

LearnPolish #PolishLanguage #Przytłoczenie #Overwhelm #PolishPodcast #MentalHealth #ZaDuzo #TooMuch #Stres #Stress #NieDajeRady #ICantHandleIt #ZrobPrzerwe #TakeABreak #LearnPolishOnline #PolishVocabulary #LanguageLearning #PolishCulture #Mindfulness #SelfCare #Shorts #LanguageShorts #Polyglot #StudyPolish #PolishForBeginners #Wellness #MentalHealthAwareness #BurnoutPrevention

View Details

"Disco Polo" is Poland's most iconic—and polarizing—music genre, and in this energetic micro-lesson you'll say it like you're front row at a summer festival in Olsztyn.First you hear the phrase at native speed, then slowed down so you can master the punchy "Disco" and the flowing "Polo." We drop it into three dance-floor-ready sentences:– "Kocham disco polo" (I love disco polo) – "Tańczmy" (Let's dance) – "To jest moja melodia" (This is my melody)Repeat-along track included—perfect while you practice your moves or defend your playlist to skeptical friends.Challenge: Tell us in the comments—do YOU love or hate disco polo? Reply in Polish and join the great Polish debate. 🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

✦ Instagram: https://www.instagram.com/learnpolishpodcast/

Teatro de idiomas

Polish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.instagram.com/teatrodeidiomas/

https://teatrodeidiomas.pl/pl/

I have just launched my PodFather Podcast Coach Community https://www.skool.com/podfather/about

Start your own SKOOl Academy https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

Do you want to unlock your potential?

https://www.skool.com/brainfitness/about

#LearnPolish #PolishLanguage #DiscoPolo #PolishMusic #PolishPodcast #KochamDiscoPolo #PolskaMuzyka #Taniec #Dance #MuzykaTaniec #LearnPolishOnline #PolishVocabulary #LanguageLearning #PolishCulture #PolishParty #Impreza #Tańczmy #Melodia #Shorts #LanguageShorts #Polyglot #StudyPolish #PolishForBeginners #Olsztyn #SummerFestival #PolishDebate disco polodee-skoh poh-lohI lovekochamkoh-hahmI likelubięloo-byehdancetaniectah-nyetslet's dancetańczmytahyn-chmimelodymelodiameh-loh-dyahsongpiosenkapyoh-sen-kahmusicmuzykamoo-zi-kahrhythmrytmritmbeatbitbeetbassbasbahssynthesizersyntezatorsin-teh-zah-torkeyboardklawiszeklah-vee-shehaccordionakordeonah-kor-deh-onpartyimprezaeem-preh-zahfestivalfestiwalfes-tee-vahlconcertkoncertkon-tsertclubklubkloobsummerlatolah-tohhitprzebójpsheh-boo-ylyricsteksttekstchorusrefrenreh-frenversezwrotkazvrot-kahfanfanfahnto singśpiewaćshpyeh-vahchto moveruszać sięroo-shahch shehfastszybkishib-keeslowwolnyvol-niloudgłośnygwosh-niquietcichychee-hipopularpopularnypoh-poo-lar-nifamoussławnyswahv-nistargwiazdagvyahz-dahartistartysta / artystkaar-tee-stah / ar-tee-stkahbandzespółze-spoo-wstagescenasteh-nahmicrophonemikrofonmee-kro-fonspeakergłośnikgwoosh-neeksounddźwiękdzyenkto listensłuchaćswoo-hahchto hearsłyszećswi-shehchopinionopiniaoh-pee-nyahdebatedebatadeh-bah-tahlove itkocham tokoh-hahm tohhate itnienawidzę tegonyeh-nah-vee-dzeh teh-gohbestnajlepszynahy-lep-shiworstnajgorszynahy-gor-shifunzabawazah-bah-vahjokeżartzhahrtpersonosobaoh-soh-bahpeopleludzieloo-dzyeheveryonewszyscyfshis-tseetogetherrazemrah-zemenergyenergiaen-er-gyahvibeklimat / atmosferaklee-maht / ah-tmo-sfeh-raEnglishPolishPronunciation Guidedisco polodisco polodee-skoh poh-lohI lovekochamkoh-hahmI likelubięloo-byehdancetaniectah-nyetslet's dancetańczmytahyn-chmimelodymelodiameh-loh-dyahsongpiosenkapyoh-sen-kahmusicmuzykamoo-zi-kahrhythmrytmritmbeatbitbeetbassbasbahssynthesizersyntezatorsin-teh-zah-torkeyboardklawiszeklah-vee-shehaccordionakordeonah-kor-deh-onpartyimprezaeem-preh-zahfestivalfestiwalfes-tee-vahlconcertkoncertkon-tsertclubklubkloobsummerlatolah-tohhitprzebójpsheh-boo-ylyricsteksttekstchorusrefrenreh-frenversezwrotkazvrot-kahfanfanfahnto singśpiewaćshpyeh-vahchto moveruszać sięroo-shahch shehfastszybkishib-keeslowwolnyvol-niloudgłośnygwosh-niquietcichychee-hipopularpopularnypoh-poo-lar-nifamoussławnyswahv-nistargwiazdagvyahz-dahartistartysta / artystkaar-tee-stah / ar-tee-stkahbandzespółze-spoo-wstagescenasteh-nahmicrophonemikrofonmee-kro-fonspeakergłośnikgwoosh-neeksounddźwiękdzyenkto listensłuchaćswoo-hahchto hearsłyszećswi-shehchopinionopiniaoh-pee-nyahdebatedebatadeh-bah-tahlove itkocham tokoh-hahm tohhate itnienawidzę tegonyeh-nah-vee-dzeh teh-gohbestnajlepszynahy-lep-shiworstnajgorszynahy-gor-shifunzabawazah-bah-vahjokeżartzhahrtpersonosobaoh-soh-bahpeopleludzieloo-dzyeheveryonewszyscyfshis-tseetogetherrazemrah-zemenergyenergiaen-er-gyahvibeklimat / atmosferaklee-maht / ah-tmo-sfeh-rah

View Details

Welcome to Learn Polish Podcast, you can find all our episodes on learnpolishpodcast.com, find everything about me, scan the QR code, go to roycolin.com, get lessons from Ania in Polish or Spanish, you'll find the links in the show notes.

In this episode Ania and Roy discuss Poland's new bottle deposit (kaucja) system—how it works, the 50 groszy deposit, issues with return machines, practical and ecological concerns, and listeners' experiences with recycling and refunds.

"Zwrot butelek" means "bottle return," and in this eco-friendly micro-lesson you'll say it like you're saving the planet one plastic bottle at a time.First you hear the phrase at native speed, then slowed down so you can master the "zw" cluster and the soft "butel." We drop it into three green-ready sentences:– "Zwracam butelki." (I'm returning bottles.) – "To jest recykling." (This is recycling.) – "Dbam o planetę." (I care about the planet.)Repeat-along track included—perfect while you sort your bins or march to the return machine.Challenge: Tell us in the comments how YOU recycle—reply in Polish and we'll feature the greenest answers What we Discussed: 01:06"Is it Profit or Just a Refund?"A quick debate on whether you're actually "earning" money or just getting back what you already paid.01:48"The 50 Groszy Hidden Cost"Explaining the mandatory deposit added to every bottle and how it impacts the final price.03:30"Why Does My Milk Bottle Fail?"A relatable moment about the frustration of machines rejecting certain types of plastic like milk bottles.03:43"Lidl vs. Biedronka Battle"The common struggle of trying to return a bottle from one store to a machine in a different store.04:05"The Ghost Machines"Highlighting the absurdity of having deposit-marked bottles but no machines available to return them.05:48"The Recycling Lie?"A controversial take on whether these bottles are actually recycled or just shipped to Asia or burned.06:09"Greenpeace Skepticism"A bold claim about how even environmental organizations might see the system as a money-making scheme.06:35"It's Just Another Tax"Comparing the bottle return system to a mandatory, "burdensome" tax that you can't avoid.07:15"Frozen Capital in My Kitchen"A funny but true observation about having "bags of money" (bottles) taking up space in your home.07:49"Is the System Actually Stupid?"A blunt final assessment of the system's effectiveness and its impact on the poor vs. the general public.EnglishPolishPronunciation Guidebottlebutelkaboo-tel-kahbottle returnzwrot butelekzvrot boo-tel-ekrecyclingrecyklingreh-TSI-klingrecyclerecyklowaćreh-tsi-kloh-vahchplasticplastikplah-steekglassszkłoshkwohcan (container)puszkapoosh-kahaluminumaluminiumah-loo-mee-nyoompaperpapierpah-pyehcardboardtektura / kartontek-too-rah / kar-tonbinkosz / pojemnikkosh / poh-yem-neektrash/garbageśmiecishmyeh-tseerubbishśmietnikshmyet-neekwasteodpadyoh-pah-disortsortowaćsor-toh-vahchseparateseparować / rozdzielaćseh-pah-roh-vahch / rohz-dzyeh-lahchcleanczyścićchish-chichreturnzwracać / oddawaćzvrah-tsahch / oh-dah-vahchdepositkaucja / zaliczkakow-tsya / zah-leech-kahrefundzwrot pieniędzyzvrot pyeh-nyend-zimachinemaszynamah-shi-nahstationstacjastahts-yahstoresklepsklehpbagtorba / worektor-bah / voh-rehkenvironmentśrodowiskoshroh-doh-vees-kohplanetplanetaplah-neh-tahearthziemiazyeh-myahnaturenaturanah-too-rahgreenzielonyzyeh-loh-nieco-friendlyprzyjazny dla środowiskapsi-yahz-ni dla shroh-doh-vees-kahsustainablezrównoważonyzroov-noh-vah-zhoh-nizero wastezero waste (same)zeh-roh weystclimateklimatklee-mahtpollutionzanieczyszczeniezah-nyeh-chish-cheh-nyehcarbon footprintślad węglowyswahd veng-woh-virenewableodnawialnyohd-nah-vyahl-nireusablewielokrotnego użytkuvyeh-loh-krot-neh-goh oo-zi-koobiodegradablebiodegradowalnybyoh-deh-grah-doh-vahl-niorganicorganicznyor-gah-neech-nilocallokalnyloh-kahl-nicommunityspołecznośćspo-wetch-noshchresponsibilityodpowiedzialnośćohd-povyed-zahl-noshchcaredbaćdbahchsaveratować / oszczędzaćrah-toh-vahch / ohsh-chend-zahchprotectchronićhroh-neechfutureprzyszłośćpsi-shwoshch🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

✦ Instagram: https://www.instagram.com/learnpolishpodcast/

Teatro de idiomas

Polish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.instagram.com/teatrodeidiomas/

https://teatrodeidiomas.pl/pl/

I have just launched my PodFather Podcast Coach Community https://www.skool.com/podfather/about

Start your own SKOOl Academy https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

Do you want to unlock your potential?

https://www.skool.com/brainfitness/about

ZwrotButelek #BottleReturn #Eko #Ekologia #GoGreen #ZeroWaste#LearnPolishOnline #PolishVocabulary #LanguageLearning #PolishCulture

View Details

What I Did as a Child – Co robiłem jako dziecko"Co robiłem jako dziecko" means "what I did as a child," and in this nostalgic micro-lesson you'll say it like you're flipping through old photo albums with your Polish grandmother.First you hear the phrase at native speed, then slowed down so you can master the rolling "r" and the soft "dziecko." We drop it into three memory-lane-ready sentences:– "Kiedy byłem mały…" (When I was little…) – "Lubiłem się bawić." (I liked to play.) – "To było dawno temu." (That was a long time ago.)Repeat-along track included—perfect while you reminisce or share your own childhood stories.Challenge: Tell us in the comments what YOU did as a child—reply in Polish and Ania might sing your answer in the next episode What we discussed: 0:00 Welcome & QR Code0:45 "Dziecko" - The Polish Word for Child1:30 Childhood Bedroom Memories2:30 Sports & Experiments3:30 School & Newspapers4:30 University & Opinions5:30 Wishes & Dashboards6:30 Stars & Classrooms7:30 Time & Dance8:30 Building & Creating9:30 Television & Media10:30 Graphs & Grades11:30 Comics & Parks12:30 Photos & Memories13:30 Games & Play14:30 Suggestions & Ideas15:30 Early Jobs & Studies16:30 Army & Activities17:30 Toys & Cars18:30 Sunset & Evening Play19:30 Mom's Voice & Family20:30 Growing Up & Yesterday21:30 Fitness & Sports22:30 Comfort & Balm23:30 National & Sharing24:30 Adult Life & Planning25:30 Vision & Yesterday's Story26:30 Short Stories & Patches27:30 Royal Games & Health28:30 Memories & Reports29:30 Calls & Moods30:30 Sports & Chores31:30 Swimming & Memories32:30 Web & Changes33:30 Books & People34:30 School Initiatives35:30 Travel & Problems36:30 Chats & Opinions37:30 Goals & School Sheets38:30 Status & Movies39:30 Platforms & QR Code40:30 Your Turn to Practice! EnglishPolishPronunciation Guidechilddzieckodzyeh-tsohchildhooddzieciństwodzyeh-cheen-stvomemorywspomnienievspo-mnyeh-nyehto rememberpamiętaćpah-myeh-tahchto forgetzapomniećzah-pom-nyehchto playbawić się / graćbah-veech sheh / grahchtoyzabawkazah-bahf-kahgamegragrahschoolszkołashkoh-wahteachernauczyciel / nauczycielkanow-chi-tyel / now-chi-tyel-kahfriendprzyjaciel / przyjaciółkapsi-ya-chyel / psi-ya-choow-kahfamilyrodzinaroh-jee-nahmommamamah-mahdadtatatah-tahbrotherbratbrahtsistersiostrasyoh-strahhomedomdohmroompokójpoh-kooybedłóżkowoo-shkohto sleepspaćspahchto eatjeśćyeshchfavorite foodulubione jedzenieoo-loo-byoh-neh yeh-dzeh-nyehsportsportsportfootball/soccerpiłka nożnapeew-kah nozh-nahping pongping pongping pongswimmingpływaniepwih-vah-nyehbicyclerowerroh-verto readczytaćchi-tahchbookksiążkakyohnsh-kahcomic bookkomikskoh-meeksTVtelewizjateh-leh-veez-yahcartoonbajkabahy-kahvideo gamegra wideo / gra komputerowagrah vyeh-deh-oh / grah kom-poo-teh-roh-vahto singśpiewaćshpyeh-vahchsongpiosenkapyoh-sen-kahto dancetańczyćtahyn-chichpartyimprezaeem-preh-zahbirthdayurodzinyoo-roh-jee-niholidaywakacje / ferievah-kah-tsyeh / feh-ryehsummerlatolah-tohwinterzimazee-mahto grow updorastaćdoh-rah-stahchadultdorosły / dorosładoh-roh-swi / doh-roh-swahyoungmłody / młodamwoh-di / mwoh-daholdstary / starastah-ri / stah-rahyesterdaywczorajfchoh-rah-ytodaydziśdzeeshtomorrowjutroyoo-trohlong agodawno temudahv-noh teh-mooalwayszawszezahf-shehnevernigdyneeg-disometimesczasamichah-sah-meeoftenczęstochen-stoh 🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

✦ Instagram: https://www.instagram.com/learnpolishpodcast/

Teatro de idiomas

Polish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.instagram.com/teatrodeidiomas/

https://teatrodeidiomas.pl/pl/

I have just launched my PodFather Podcast Coach Community https://www.skool.com/podfather/about

Start your own SKOOl Academy https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

Do you want to unlock your potential?

https://www.skool.com/brainfitness/about

#Wspomnienia #Memories #Dorastanie #GrowingUp #LearnPolishOnline#PolishVocabulary #LanguageLearning #PolishCulture #Nostalgia #Dziecko #LearnPolish #PolishLanguage #Dzieciństwo #Childhood #PolishPodcast

View Details

Easter – Wielkanoc"Wielkanoc" means "Easter," and in this festive micro-lesson you'll say it like you're gathered around the święconka basket waiting for the Easter blessing.First you hear the word at native speed, then slowed down so you can master the majestic "Wiel" and the soft "kanoc." We drop it into three celebration-ready sentences:– "Wesołych Świąt Wielkanocnych!" (Happy Easter!) – "Maluję pisanki." (I'm painting Easter eggs.) – "Idę na święconkę." (I'm going for the Easter blessing.)Repeat-along track included—perfect while you dye eggs, bake mazurek, or prepare your Easter basket.Challenge: Tell us in the comments how YOU celebrate Easter—reply in Polish and we'll feature the most festive answers. What we Discussed:0:00 Welcome & QR Code0:45 Easter Time & Opportunities1:30 Easter Movies & Bible2:30 Easter Soup & Learning3:30 Names & Traditions4:30 Easter Preparations5:30 Cleaning for Easter6:30 Easter Mushrooms & Food7:30 Easter Pockets & Apps8:30 Easter Work & Books9:30 Easter Questions10:30 Easter Kisses & Treats11:30 Easter Stage & Keys12:30 Easter Memories13:30 Easter Voting & Water14:30 White Easter & Snow15:30 Simple Easter & Robes16:30 Easter Songs & Techniques17:30 Easter Travel & Changes18:30 Good Friday19:30 Easter Chocolate20:30 Easter Duck & Cousins21:30 Family Easter & Registration22:30 Easter Design & Birthdays23:30 Easter Sounds & Sharing24:30 Easter Games & Lessons25:30 Easter Policy & Video26:30 Virtual Easter & Friends27:30 Your Turn to Practice!.

EnglishPolishPronunciation GuideEasterwielkanocvyel-kah-notsHappy Easterwesołych świątveh-soh-wikh sh'yontEaster eggspisankipee-sahn-keeEaster Mondayponiedziałek wielkanocnypoh-nyeh-dzyah-wek vyel-kah-nots-niGood Fridaywielki piątekvyel-kee pyon-tekHoly Saturdaywielka sobotavyel-kah soh-boh-tahEaster Sundayniedziela wielkanocnanyeh-dzyeh-lah vyel-kah-nots-nahEaster basketkoszyk wielkanocnykoh-shik vyel-kah-nots-niblessingbłogosławieństwobwoh-goh-swah-vyehn-stfohchurchkościółkohsh-choo-wpriestksiądzkyohnshholy waterwoda święconavoh-dah sh'yehn-tsaw-nahlamb (Easter)baranekbah-rah-nehkhamszynkashinkasausagekiełbasakyehw-bah-sahbreadchlebhlehpcakeciasto / mazurekchahs-toh / mah-zoo-rehkchocolateczekoladache-ko-lah-dahbunnykrólik / zajączekkroo-leek / zah-yon-chehkchickkurczaczek / pisklękoor-chah-chehk / peesk-wengspringwiosnavyohs-nahresurrectionzmartwychwstaniezmar-tvih-stah-nyehfaithwiaravyah-rahfamilyrodzinaroh-jee-nahtraditiontradycjatrah-di-tsyacustomzwyczajzvi-chahydecoratedekorowaćdeh-ko-roh-vahchpaintmalowaćmah-loh-vahchdyebarwićbar-veechpatternwzórvzoorcolorkolorkoh-lorredczerwonycher-voh-nigreenzielonyzyeh-loh-niyellowżółtyzhoo-tihunt (eggs)szukaćshoo-kahchfindznaleźćznah-lehshchhidechowaćhoh-vahchbasketkoszykkoh-shikwillow branchbaziebah-zyehpalmpalmapahl-mahprocessionprocesjaproh-tseh-tsya#LearnPolish #PolishLanguage #Wielkanoc #Easter #PolishPodcast #WesołychŚwiąt #Pisanki #Święconka #WielkiPiątek #PolishTradition #PolishCulture #LearnPolishOnline #PolishVocabulary #LanguageLearning #EasterEggs #EasterMonday #PolishHolidays #Shorts #LanguageShorts #Polyglot #StudyPolish #PolishForBeginners

View Details

Music – Muzyka "Muzyka" means "music," and in this micro-lesson you'll say it like you're front row at a Warsaw concert with your favorite playlist on repeat. First you hear the word at native speed, then slowed down so you can master the soft "mu" and the flowing "zyka." We drop it into three earworm-ready sentences: – "Kocham muzykę." (I love music.)– "To moja playlista." (This is my playlist.)– "Gram na gitarze." (I play guitar.) Repeat-along track included—perfect while you queue Spotify, tune your instrument, or discover your next favorite Polish artist. Challenge: Tell us in the comments what music YOU love and if you play any instruments—reply in Polish for bonus points. What we Discussed:0:00 Welcome & QR Code0:45 "Muzyka" - The Polish Word for Music1:30 Promoting Your Music2:30 Music Problems & Solutions3:30 Electronic & Digital Music4:30 Instruments: Violin & Techno5:30 Music Theory: Keys & Modes6:30 Music Structure & Measures7:30 Playlists & Spotify8:30 Shazam & Music Discovery9:30 Sharing Music10:30 Music Mentorship11:30 Home Studio Setup12:30 Albums & Collections13:30 Bonus Tracks & Extras14:30 Testing Your Sound15:30 Audio Engineering16:30 Music Collaboration17:30 Music Business & Customers18:30 Music Journalism19:30 Live Festivals20:30 Techno & Electronic21:30 Saxophone & Instruments22:30 Music Rights & Consent23:30 Music Journeys24:30 Classical & Opera25:30 Music Libraries26:30 Family & Music27:30 Spotify & Streaming28:30 Clubs & Nightlife29:30 Gaming Music30:30 Record Stores31:30 Active Listening32:30 Musical Destiny33:30 Gear: Amplifiers34:30 Music Organization35:30 Universal Music36:30 Guitar Feature37:30 Musical Talent38:30 Your Turn to Practice

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

✦ Instagram: https://www.instagram.com/learnpolishpodcast/

Teatro de idiomas

Polish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.instagram.com/teatrodeidiomas/

https://teatrodeidiomas.pl/pl/

I have just launched my PodFather Podcast Coach Community https://www.skool.com/podfather/about

Start your own SKOOl Academy https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

Do you want to unlock your potential?

https://www.skool.com/brainfitness/about

LearnPolish #PolishLanguage #Muzyka #Music #PolishPodcast#PolishMusic #Playlist #Spotify #Gitara #Perkusja #Techno#LearnPolishOnline #PolishVocabulary #LanguageLearning #PolishCulture#Shorts #LanguageShorts #Polyglot #StudyPolish #PolishForBeginners#MusicLovers #Instrument #NowPlaying #MusicIsLife #PolishArtistsKeywords: English → PolishTable EnglishPolishPronunciation Guidemusicmuzykamoo-zi-kahplaylistplaylistapley-lee-stahguitargitaragee-tah-rahdrumsperkusjaper-koo-syahviolinskrzypceskship-tsehsaxophonesaksofonsah-kso-fonbandzespółze-spoo-wsongpiosenkapyoh-sen-kahalbumalbumahl-boomconcertkoncertkon-tsertfestivalfestiwalfes-tee-vahlclubklubkloobSpotifySpotify (same)spo-tee-fahyShazamShazam (same)shah-zahmplaylistplaylistapley-lee-stahelectronicelektronicznael-ek-tro-neech-nahtechnotechno (same)teh-knoclassicalklasycznaklah-sich-nahoperaopera (same)oh-peh-rahinstrumentinstrumenteen-stroo-mentamplifierwzmacniaczvzma-chahnychspeakergłośnikgwoosh-neekaudioaudio (same)ow-dyohsounddźwiękdzyenklistensłuchaćswoo-hahchplay (instrument)graćgrahchsingśpiewaćshpyeh-vahchlove (verb)kochamkoh-hahmfavoriteulubionyoo-loo-byoh-nidiscoverodkrywaćohd-kri-vahchsharedzielićdye-lee-chdownloadpobraćpoh-brahchstreamstreamowaćstree-moh-vahchrecordnagrywaćnah-gri-vahchproduceprodukowaćpro-doo-koh-vahchmixmiksowaćmeeks-oh-vahchbeatbitbeetrhythmrytmritmmelodymelodiameh-loh-dyahlyricsteksttekstvoicegłosgwoschoirchórhoororchestraorkiestraor-kyeh-strahstagescenasteh-nahmicrophonemikrofonmee-kro-fonheadphonessłuchawkiswoo-hahf-kee

View Details

Spring – Wiosna "Wiosna" means "spring," and in this fresh micro-lesson you'll say it like you're throwing open the windows after a long Polish winter. First you hear the word at native speed, then slowed down so you can master the soft "wio" and the flowing "sna." We drop it into three renewal-ready sentences: – "Kocham wiosnę." (I love spring.) – "To czas na zmiany." (It's time for changes.) – "Robię wiosenne porządki." (I'm doing spring cleaning.) Repeat-along track included—perfect while you air out the apartment or plant your first flowers. Challenge: Tell us in the comments what spring changes YOU are making—or just write "Wiosna przyszła" (Spring has come) What we Discussed:0:00 Welcome & QR Code0:45 "Wiosna" - The Polish Word for Spring1:30 Spring Budget & Planning2:30 Fresh Starts & Promises3:30 Digital Spring Cleaning4:30 Physical Spring Cleaning5:30 Tackling Clutter6:30 New Perspectives7:30 Setting Spring Goals8:30 Personal Growth9:30 Clear Vision10:30 Scaling Up11:30 Community & Nation12:30 Fresh Beginnings13:30 Nature Awakening14:30 Sun Worship15:30 Spring Playfulness16:30 Spring Elegance17:30 Financial Spring18:30 Spring Relationships19:30 Community Growth20:30 Winter to Spring Transition21:30 Spring Calendar22:30 Journey Metaphor23:30 Spring Conversations24:30 Spring Paperwork25:30 Spring Semester26:30 Key to Spring27:30 Spring Running28:30 Spring Reflection29:30 Spring Projects30:30 Wiosenne Porządki - Spring Cleaning31:30 Spring Shadows & Gardens32:30 Spring Learning & Growth33:30 Your Turn to Practice

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

✦ Instagram: https://www.instagram.com/learnpolishpodcast/

Teatro de idiomas

Polish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.instagram.com/teatrodeidiomas/

https://teatrodeidiomas.pl/pl/

I have just launched my PodFather Podcast Coach Community https://www.skool.com/podfather/about

Start your own SKOOl Academy https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

Do you want to unlock your potential?

https://www.skool.com/brainfitness/about

LearnPolish #PolishLanguage #Wiosna #Spring #PolishPodcast

WiosennePorządki #SpringCleaning #NowyPoczątek #NewBeginning #LearnPolishOnline#PolishVocabulary #LanguageLearning #PolishCulture #PolishSpring #Zmiany #Changes

Shorts #LanguageShorts #Polyglot #StudyPolish #PolishForBeginners#SpringVibes #FreshStart #Seasonal #Spring2026 #MotivationTable EnglishPolishPronunciation Guidespringwiosnavyohs-nahspring cleaningwiosenne porządkivyoh-seh-neh por-jon-keenew beginningnowy począteknoh-vi poh-chon-tekchangezmianazmyah-nahgrowthwzrostvzrostfresh startświeży startshvyeh-zhi startcleanczysty / czyścićchis-ti / chish-chichorganizeorganizowaćor-gah-nee-zoh-vahchdeclutterpozbyć się niepotrzebnych rzeczypoz-bich sheh nyeh-po-treh-bnikh zheh-chihomedomdohmgardenogródoh-grootflowerkwiatkv-yahtsunsłońceswohn-tsehnaturenaturanah-too-rahgreenzielonyzyeh-loh-nifreshświeżyshvyeh-zhibudgetbudżetboo-jetgoalceltselpurposecel / przeznaczenietsel / pshehz-nah-cheh-nyehplanplanplahnjourneypodróżpoh-drooshtimeczaschahscommunityspołecznośćspo-wetch-noshchopportunityszansa / okazjashahn-sah / oh-kah-zyahwishżyczeniezhi-cheh-nyehdreamsen / marzeniesen / mar-zeh-nyehhopenadziejanah-dzyeh-yahrenewodnowićohd-noh-veechrefreshodświeżyćohd-shvyeh-zichrestartzrestartowaćzreh-star-toh-vahchclean slateczysta kartkachis-tah kart-kahopen windowotwarte oknooht-var-teh ok-nohfresh airświeże powietrzeshvyeh-zheh poh-vyeh-tchehplantingsadzeniesahd-zeh-nyehbloomingkwitnieniekfeet-nyeh-nyehawakeningprzebudzeniepsheh-boo-dzeh-nyehenergyenergiaen-er-gyahmotivationmotywacjamo-tiv-ah-tsyainspirationinspiracjaeen-spee-rah-tsya

View Details

Fat Thursday – Tłusty Czwartek "Tłusty Czwartek" means "Fat Thursday," and in this delicious micro-lesson you'll say it like you're queuing at the best pączek shop in Warsaw with powdered sugar on your chin. First you hear the phrase at native speed, then slowed down so you can master the tricky "ł" and the flowing "Czwartek." We drop it into three sugar-rush-ready sentences: – "Kocham pączki!" (I love donuts!) – "Dziś jest Tłusty Czwartek." (Today is Fat Thursday.) – "Zjem dziesięć pączków" (I'll eat ten donuts) Repeat-along track included—perfect while you fry, fill, or feast on your favorite pączki. Challenge: Tell us in the comments how many pączki YOU ate this last Fat Thursday—or just write "Pączki są pyszne" (Donuts are delicious) 0:00 Welcome & QR Code0:45 "Tłusty Czwartek" - The Polish Word for Fat Thursday1:30 Pistachio & Chocolate Fillings2:30 Popular Polish Traditions3:30 Pączki Layers & Baking4:30 Sugar Rush Energy5:30 Finding the Best Bakery6:30 Funny Food Moments7:30 Calendar & Holiday Timing8:30 Recipe Ingredients9:30 Energy & Celebration10:30 Banana & Creative Fillings11:30 Work vs. Donuts Dilemma12:30 Eating Challenges13:30 Social Media & Sharing14:30 Your Turn to Practice

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

✦ Instagram: https://www.instagram.com/learnpolishpodcast/

Teatro de idiomas

Polish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.instagram.com/teatrodeidiomas/

https://teatrodeidiomas.pl/pl/

I have just launched my PodFather Podcast Coach Community https://www.skool.com/podfather/about

Start your own SKOOl Academy https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

Do you want to unlock your potential?

https://www.skool.com/brainfitness/about

LearnPolish #PolishLanguage #TłustyCzwartek #FatThursday #PolishPodcast

Pączki #PolishDonuts #PolishTradition #LearnPolishOnline #PolishVocabulary#LanguageLearning #PolishCulture #PolishFood #WielkiPost #Lent

Shorts #LanguageShorts #Polyglot #StudyPolish #PolishForBeginners#Foodie #DonutDay #PolishBakery #SweetTooth #ComfortFoodTable EnglishPolishPronunciation GuideFat ThursdayTłusty Czwartektwo-stee chvar-tekdonutpączekpon-chekdonuts (plural)pączkiponch-keepistachiopistacja / pistacjowypee-sta-tsya / pee-sta-cho-vichocolateczekoladache-ko-la-dapopularpopularnypo-poo-lar-nistoryopowieśćo-po-vyeshchlayerwarstwavar-stvapopulationpopulacjapo-poo-la-tsyabakingwypiekvi-pyekdancetaniectah-nyetsstoresklepsklehppinkróżowyroo-zo-visilly/goofygłupigwoo-peeseconddrugidroo-geepinchszczypshchipselfsam / samasahm / sah-mahenergy drinkenergetyk / napój energetycznyen-er-ge-tik / nah-poo-y en-er-ge-tich-nibananabananbah-nahngood/OKdobra / dobrzedoh-brah / doh-bzhehworkpracapra-tsahchallengewyzwanieviz-vah-nyehpeopleludzieloo-jyehcareerkarieraka-tyeh-rahtimeczaschahsgamegragrahcontenttreśćtreschmachinemaszynamah-shi-nahmessagewiadomośćvya-doh-moshchmusicmuzykamoo-zi-kanevernigdyneeg-distagescena / etapsteh-nah / eh-tahpstudystudiować / naukastoo-dyo-vahch / now-kaactiveaktywnyahk-tiv-nipointpunktpunkhtcomingnadchodzący / przychodzącynah-ho-dzoh-n-tsi / psi-ho-dzoh-n-tsiyestaktahkactuallywłaściwie / faktycznievwahsh-chyeh-vyeh / fahk-tich-nyehvideowideovyeh-deh-ohtinymalutki / malutkamah-look-kee / mah-look-kahpunchcios / uderzeniechohs / oo-der-zeh-nyehsalessprzedażsprzeh-dahshdestroyniszczyćneesh-chichamazingniesamowity / niesamowitanyeh-sah-mo-vee-tee / nyeh-sah-mo-vee-tahsingrzechgzhehkhbatchpartia / wsadpar-tyah / fsahdshortkrótki / krótkakroot-kee / kroot-kahgoogleGoogle (same)goo-glehnameimię / nazwaee-myeh / nah-zvahstopstop / przystanekstop / psi-stah-nehkserviceusługa / serwisoo-swoo-gah / ser-veesselfsam / siebiesahm / sheh-byehbunchkilka / wiązkakeel-kah / vyonz-kahenergyenergiaen-er-gyahbarbarbahrneedpotrzeba / potrzebowaćpot-sheh-bah / pot-sheh-bo-vahchoptionalopcjonalnyop-tsyo-nahl-nimocknaśladować / udawaćnah-shwah-do-vahch / oo-dah-vahchpaidpłatnypwah-tnifitpasować / dopasowanypah-so-vahch / do-pah-so-vah-nicareerkarieraka-tyeh-rahartistartysta / artystkaar-ti-stah / ar-ti-stkahhelppomoc / pomagaćpo-mots / po-mah-gahchcommentkomentarzko-men-tahshfeelczućchoochexporteksportek-sporttaskzadaniezah-dah-nyehhandsręceren-tsehfriendprzyjaciel / przyjaciółkapsi-ya-chyel / psi-ya-choow-kah

View Details

Wedding – Ślub "Ślub" means "wedding," and in this micro-lesson you'll say it like you're toasting the newlyweds at a Polish wesele. First you hear the word at native speed, then slowed down so you can master the tricky "ś" and the soft "lub." We drop it into three celebration-ready sentences: – "Idę na ślub." (I'm going to a wedding.) – "To będzie piękny ślub." (It's going to be a beautiful wedding.) – "Sto lat dla nowożeńców!" (One hundred years for the newlyweds) Repeat-along track included—perfect while you pick your outfit or practice your toast. Challenge: Tell us in the comments about the last Polish wedding you attended—or write "Idę na ślub!" if you have one coming up. Timestamps & Descriptions0:00 Welcome & QR Code0:45 "Ślub" - The Polish Word for Wedding1:30 Wedding Memories & Traditions2:30 Planning & Organization3:30 Polish Wedding Drinks & Toast4:30 Music & Entertainment5:30 Love & Celebration6:30 Wedding Logistics & Tech7:30 The Perfect Toast8:30 Family & Generations9:30 Wedding Shopping & Expenses10:30 Final Tips & Suggestions11:30 Your Turn to Practice

Table EnglishPolishPronunciation Guideweddingślubshloopmarriagemałżeństwomaw-zhehn-stvobridepanna młodapanna mwo-dagroompan młodypan mwo-dinewlywedsnowożeńcyno-vo-zhehn-tsiwedding partyweseleve-se-letoasttoasttohstone hundred yearssto latstoh lahtI love youkocham ciękoh-hahm chyehbeautifulpięknypyenk-niinvitationzaproszenieza-pro-sheh-nyehchurchkościółkohsh-choo-wringsobrączkio-bronch-kibouquetbukietboo-kyethoneymoonpodróż poślubnapoh-droosh posh-loob-nafamilyrodzinaroh-jee-nacelebrationcelebracjatse-le-bra-tsyadancetaniectah-nyetsmusicmuzykamoo-zi-kavodkawódkavoo-dkawhiskeywhiskywee-skibandzespółze-spoo-wmemorypamięćpah-myenchorganizezorganizowaćzor-gah-nee-zoh-vahchwebsitestronastroh-namoneypieniądzepyeh-nyon-dzehomedomdohmchallengewyzwanieviz-vah-nyehdeviceurządzenieoo-zhon-dzeh-nyehpaymentpłatnośćpwat-nohshchproductproduktpro-duktsuggestionsugestiasoo-ges-tyahgenerationgeneracjage-ne-ra-tsyadashboardkokpit / panelkohk-peet / pah-nelstoresklepsklehpmissionmisjamee-shahperfectdoskonałydoh-skoh-nah-wibeautiful daypiękny dzieńpyenk-ni dzyen🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

✦ Instagram: https://www.instagram.com/learnpolishpodcast/

Teatro de idiomas

Polish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.instagram.com/teatrodeidiomas/

https://teatrodeidiomas.pl/pl/

I have just launched my PodFather Podcast Coach Community https://www.skool.com/podfather/about

Start your own SKOOl Academy https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

Do you want to unlock your potential?

https://www.skool.com/brainfitness/about

PolishWedding #Wesele #LearnPolishOnline #PolishVocabulary #LanguageLearning#PolishTradition #WeddingVows #StoLat #Nowożeńcy #PolishCulture#PolishWedding #Wesele #LearnPolishOnline #PolishVocabulary #LanguageLearning#PolishTradition #WeddingVows #StoLat #Nowożeńcy #PolishCulture#Shorts #LanguageShorts #Polyglot #StudyPolish #PolishForBeginners#WeddingSeason #BrideToBe #WeddingPlanning #PolishBride

View Details

"Muzyka" means "music," and in this micro-lesson you'll say it like you're front row at a Warsaw concert. First you hear the word at native speed, then slowed down so you can nail the soft "zy" and the flowing "ka." We drop it into three earworm-ready sentences:– "Kocham muzykę." (I love music.) – "To moja playlista." (This is my playlist.) – "Gram na gitarze." (I play guitar.) Repeat-along track included—perfect while you queue Spotify or tune your instrument. Challenge: Tell us in the comments what music YOU like and if you play any instruments—reply in Polish for bonus points. What we DiscussedL 0:00 Welcome & QR Code0:45 "Impreza" - The Polish Word for Party1:30 Disco Polo Culture2:30 Party Vocabulary in Action3:30 Nightlife Phrases5:30 Club & Music Terms7:30 Social Situations9:30 Weekend & Fun11:30 Your Turn to Practice🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

✦ Instagram: https://www.instagram.com/learnpolishpodcast/

Teatro de idiomas

Polish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.instagram.com/teatrodeidiomas/

https://teatrodeidiomas.pl/pl/

I have just launched my PodFather Podcast Coach Community https://www.skool.com/podfather/about

Start your own SKOOl Academy https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

Do you want to unlock your potential?

https://www.skool.com/brainfitness/about

View Details

Discover the hidden strategies behind websites that turn casual browsers into loyal customers without expensive ads or complicated funnels.

This Episode is a Promotional Episode for the Website services that we offer at ⁠va.world⁠

What we Discussed:

00:00 Why we Recorded this Episode

00:47 Why do you want a Website?

01:36 How to Make Sure a Website Converts

02:55 The Biggest Mistake Businesses Make when Creating a Website

04:30 How Important is Brand Clarify with your Website

05:10 What questions to ask Clients before building their Website

06:34 Allow Disability access for your Website

07:30 Align a Website with the Companies Long Term Goals

08:40 We have worked over 5 years together and have not had an argument.

09:40 What makes a Website Stand Out

10:54 How to approach User experience on your Website

11:53 How Annoying Pop Up's are on Websites

12:35 Design Psychology for Improving your Website

13:44 Ensure you can see the Text on the Website

14:03 Speed & Performance for Website Success

15:22 How to Ensure a Website works across different Devices

16:22 How the Wesbite helped a client with ongoing Upgrades

18:20 How our Design improved Conversions on the Website

19:20 Feedback from Clients after Creating their Websites

20:54 Do not be to Pushy with Sales on the Website

21:35 How the Cookies Help with Sales on your Websites

22:30 Tracking on all Prts of your Website

23:11 Website are like Podcasts that have a lot of things to make it Successful

24:28 How to be be Safe adding Payment Options on your Website

26:15 Maintaining Your Website with our VA

27:32 Do not Managing your own Website if you want to grow your business

29:04 We Create Packages with a breakdown of costs

29:48 Staying ahead of website trends like Ai

30:53 What Website Platforms do we Specialise in

32:38 How do you Future Proof a Website

33:09 We Help Create Skool Groups

33:22 Difference between a Template Site and a Strategically Built Website

34:50 Some Templates Require Plugins

36:00 Amature Websites V's Professionally Designed Ones

37:00 The Problem getting the Wrong Website Template

37:32 How Important is Messaging compared to Visuals on the Website

38:47 How Long should a homepage be on your Website

39:57 The Process from Concept to Launch of your Website

40:57 Having Your Socials connected on your Website

41:37 Do you need a New Website

42:15 How to Connect with us for a New Website

44:35 My 6 Podcasts got 110K downloads last week

Find our Website ⁠va.world⁠

Book a Free Call ⁠https://va.world/contact/⁠

#WebsiteDesign #ConversionOptimization #OnlineBusiness #DigitalMarketing #VAservices #BusinessGrowth

View Details

Episode Overview: Dlaczego Kłamiemy (Why We Lie)This episode explores vocabulary related to lying (kłamstwo), truth (prawda), trust (zaufanie), and human behavior (zachowanie człowieka) in Polish. We dive into how to discuss deception, honesty, social masks, and the complex reasons people hide the truth – all in practical, everyday Polish. Welcome to the Learn Polish Podcast – your immersive gateway to mastering Polish through real conversations, cultural insights, and practical everyday language. Each episode blends authentic Polish dialogue with clear English explanations, helping you build vocabulary naturally while exploring Polish psychology, social dynamics, and human behavior topics. Whether you're a complete beginner or advancing your skills, join us as we make learning Polish engaging, practical, and fun. From lying (kłamstwo) to truth (prawda), we cover the phrases you actually need for deeper conversations. Find more episodes, lesson materials, and resources at www.learnpolishpodcast.com. You can also find us on YouTube, Spotify, and Rumble. Looking for virtual assistance? Visit va.world. Join our school groups – links in the show notes. Need lessons in Polish or Spanish from Ania? Check the links for both audio and video content. EnglishPolishPronunciationExample UsageLie (noun)Kłamstwokwahm-STVOTo jest kłamstwo. (This is a lie.)Lie (verb)KłamaćKWA-machOn kłamie. (He is lying.)LiarKłamcaKWAHM-tsahOn jest kłamcą. (He is a liar.)TruthPrawdaPRAHV-dahMów prawdę. (Tell the truth.)TruePrawdziwyprahv-DZEE-vihPrawdziwa historia. (True story.)FalseFałszywyfow-SHIH-vihFałszywe informacje. (False information.)TrustZaufaniezow-FAH-nyehMam zaufanie. (I have trust.)DistrustNieufnośćnyeh-uf-NOSHCHNieufność do ludzi. (Distrust of people.)HonestyUczciwośćoo-CHCHEEV-oshchCenię uczciwość. (I value honesty.)DishonestyNieuczciwośćnyeh-oo-CHCHEEV-oshchNieuczciwość boli. (Dishonesty hurts.)DeceptionOszustwooh-SOOST-voTo było oszustwo. (That was deception.)DeceiveOszukiwaćo-soo-KEE-vachOn oszukuje. (He deceives.)SecretSekretSEH-kretTo mój sekret. (This is my secret.)Hide (verb)Ukrywaćoo-KRIH-vachUkrywam prawdę. (I hide the truth.)MaskMaskaMAH-skahNosimy maski. (We wear masks.)FaceTwarztfarshPrawdziwa twarz. (True face.)BehaviorZachowanieza-kho-VAH-nyehDziwne zachowanie. (Strange behavior.)ActionDziałaniedzyah-WAH-nyehTwoje działania. (Your actions.)ReactionReakcjareh-AK-tsyaReakcja na kłamstwo. (Reaction to the lie.)EmotionEmocjaeh-MO-tsyaUkrywać emocje. (Hide emotions.)FeelingUczucieoo-CHOO-tsehPrawdziwe uczucia. (True feelings.)ThoughtMyślmishlMoje myśli. (My thoughts.)BeliefPrzekonaniepsheh-ko-NAH-nyehMoje przekonania. (My beliefs.)OpinionOpiniao-PEE-nyaTwoja opinia. (Your opinion.)JudgmentOsądO-soontNie osądzaj. (Don't judge.)GuiltWina / Poczucie winyVEE-nah / po-CHOO-tseh VEE-nihCzuję winę. (I feel guilt.)ShameWstydvstitTo wstydliwe. (It's shameful.)FearStrachstrakhStrach przed prawdą. (Fear of truth.)Shame (verb)Wstydzić sięvsti-DZEECH shehWstydzę się. (I'm ashamed.)ProtectChronićHRO-neechChronię siebie. (I protect myself.)DefenseObronaob-RO-nahMechanizm obronny. (Defense mechanism.)MechanismMechanizmmeh-KHAH-nizmMechanizm obronny. (Defense mechanism.)ReasonPowódPO-vootJaki powód? (What reason?)PurposeCeltselJaki cel? (What purpose?)IntentionZamiarZAH-myahrMój zamiar. (My intention.)MotiveMotywMO-tifUkryty motyw. (Hidden motive.)BenefitKorzyśćKO-zishchJaka korzyść? (What benefit?)AdvantageZaletazah-LEH-tahZaleta kłamstwa. (Advantage of lying.)DisadvantageWada / NiedogodnośćVAH-dah / nyeh-dog-OD-noshchWada kłamstwa. (Disadvantage of lying.)ConsequenceKonsekwencjakon-seh-KVEN-tsyaKonsekwencje kłamstw. (Consequences of lies.)ResultWynikVIH-nikWynik działania. (Result of action.)EvidenceDowódDO-vootBrak dowodów. (No evidence.)ProofDówód / Potwierdzeniedo-Voot / pot-vyer-DZEN-yehPotrzebuję dowodu. (I need proof.)DoubtWątpliwośćvont-PLEEV-oshchMam wątpliwości. (I have doubts.)SuspicionPodejrzeniepo-deh-ZHEN-yehMoje podejrzenia. (My suspicions.)AccusationOskarżenieo-skar-ZHEN-yehFałszywe oskarżenie. (False accusation.)ForgivenessWybaczenievih-bah-CHEN-yehProszę o wybaczenie. (I ask for forgiveness.)ApologyPrzeprosinypsheh-pro-SEE-nihMoje przeprosiny. (My apologies.)AdmitPrzyznać siępshi-ZNAHCH shehPrzyznaję się. (I admit.)DenyZaprzeczaćzah-PSHEH-chachOn zaprzecza. (He denies.)ConfessWyznaćvih-ZNAHCHWyznaję prawdę. (I confess the truth.)ExposeOdsłonić / Ujawnićod-SWO-neech / oo-YAV-neechOdsłonić prawdę. (Expose the truth.)RevealUjawnićoo-YAV-neechUjawnić sekret. (Reveal the secret.)DiscoverOdkryćod-KRIHCHOdkryć kłamstwo. (Discover the lie.)RealizeZdać sobie sprawę / Uświadomić sobieZDAHCH SOH-byeh SPRAH-veh / oo-shvah-DO-meech SOH-byehZdałem sobie sprawę. (I realized.)UnderstandRozumiećro-ZOO-myechRozumiem dlaczego. (I understand why.)AcceptAkceptowaćak-tsep-TO-vachAkceptuję prawdę. (I accept the truth.)ChangeZmianaZMYAH-nahCzas na zmianę. (Time for change.)GrowthRozwójroz-VOOYOsobisty rozwój. (Personal growth.)SelfJa / Siebieyah / SHEH-byehMoje prawdziwe ja. (My true self.)EgoEgoEH-goMoje ego. (My ego.)IdentityTożsamośćtoh-shah-MOSHCHMoja tożsamość. (My identity.)ImageWizerunekvee-zeh-ROO-nekPubliczny wizerunek. (Public image.)ReputationReputacjare-poo-TA-tsyaMoja reputacja. (My reputation.)SocialSpołecznyspo-WECH-nihNormy społeczne. (Social norms.)SocietySpołeczeństwospo-weh-CHEN-stvoW naszym społeczeństwie. (In our society.)CultureKulturakool-TOO-rahKultura kłamstwa. (Culture of lying.)RelationshipRelacja / Związekre-LA-tsya / ZVYON-zekRelacje z ludźmi. (Relationships with people.)CommunicationKomunikacjako-moo-nee-KA-tsyaSztuka komunikacji. (Art of communication.)ConversationRozmowaroz-MO-vahSzczera rozmowa. (Honest conversation.)SilenceCiszaCHEE-shahNiekomfortowa cisza. (Uncomfortable silence.)SpeakMówićMOO-veechMów prawdę. (Speak the truth.)ListenSłuchaćSWOO-hachSłuchaj uważnie. (Listen carefully.)HearSłyszećSWIH-shehSłyszę cię. (I hear you.)SeeWidziećVEE-dyechWidzę prawdę. (I see the truth.)LookPatrzećPAH-tchehPatrz na mnie. (Look at me.)WatchObserwowaćob-ser-VO-vachObserwuję zachowanie. (I watch behavior.)NoticeZauważyćzow-NAH-vihchZauważyłem kłamstwo. (I noticed the lie.)RecognizeRozpoznaćroz-POZ-nachRozpoznać kłamcę. (Recognize the liar.)RememberPamiętaćpah-MYEN-tachPamiętam prawdę. (I remember the truth.)ForgetZapomniećzah-POM-nyechZapomnieć kłamstwo. (Forget the lie.)ForgiveWybaczyćvih-BAH-chihWybaczam ci. (I forgive you.)Trust (verb)UfaćOO-fachUfam ci. (I trust you.)BelieveWierzyćVYEH-zihchWierzę w ciebie. (I believe in you.)Doubt (verb)WątpićVONT-peechWątpię w to. (I doubt it.)QuestionKwestionować / Pytaćkves-tyo-NO-vach / PIH-tachKwestionować wszystko. (Question everything.)AnswerOdpowiedźod-PO-vyeshSzczera odpowiedź. (Honest answer.)AskPytaćPIH-tachPytaj o prawdę. (Ask about the truth.)TellPowiedziećpo-VYEH-dyechPowiedz prawdę. (Tell the truth.)SayMówić / PowiedziećMOO-veech / po-VYEH-dyechCo chcesz powiedzieć? (What do you want to say?)MeanZnaczyćZNAH-chihCo to znaczy? (What does it mean?)ExplainWyjaśnićvih-YASH-neechWyjaśnij mi. (Explain to me.)Understand (noun)Zrozumieniezro-zoo-MYEN-yehBrak zrozumienia. (Lack of understanding.)MisunderstandingNieporozumienienyeh-po-ro-zoo-MYEN-yehTo nieporozumienie. (This is a misunderstanding.)ConflictKonfliktKON-fliktKonflikt z prawdą. (Conflict with truth.)ResolutionRozwiązanieroz-vy-ZA-nyehRozwiązanie problemu. (Resolution of the problem.)PeaceSpokójSPO-kooyWewnętrzny spokój. (Inner peace.)HarmonyHarmoniahar-MO-nyaHarmonia z prawdą. (Harmony with truth.)AuthenticAutentycznyow-ten-TIH-nihAutentyczny człowiek. (Authentic person.)GenuinePrawdziwy / Szczeryprahv-DZEE-vih / SHCHEH-rihSzczery człowiek. (Genuine person.)SincereSzczerySHCHEH-rihSzczere przeprosiny. (Sincere apologies.)FakeFałszywy / Sztucznyfow-SHIH-vih / SHTOOCH-nihFałszywy uśmiech. (Fake smile.)RealPrawdziwy / Rzeczywistyprahv-DZEE-vih / zheh-CHIH-vistihPrawdziwa twarz. (Real face.)NaturalNaturalnynah-too-RAHL-nihNaturalne zachowanie. (Natural behavior.)ArtificialSztucznySHTOOCH-nihSztuczny świat. (Artificial world.)DeepGłębokigwem-BO-keeGłęboka prawda. (Deep truth.)SurfacePowierzchnia / Powierzchownypo-vyer-HNYAH / po-vyer-HHOV-nihPowierzchowna prawda. (Surface truth.)ComplexZłożonyZWO-zho-nihZłożona sytuacja. (Complex situation.)SimpleProstyPRO-stihProsta prawda. (Simple truth.)ComplicatedSkomplikowanyskom-plee-KO-vah-nihSkomplikowana relacja. (Complicated relationship.)ClearJasnyYAH-snihJasna sprawa. (Clear matter.)ConfusedZmieszanyzmyeh-SHAH-nihJestem zmieszany. (I'm confused.)CertainPewnyPEHV-nihJestem pewny. (I'm certain.)UncertainNiepewnynyeh-PEHV-nihJestem niepewny. (I'm uncertain.)SurePewny / Na pewnoPEHV-nih / nah PEHV-noNa pewno? (For sure?)MaybeMożeMO-zhehMoże tak, może nie. (Maybe yes, maybe no.)ProbablyPrawdopodobnieprahv-do-POD-ob-nyehPrawdopodobnie tak. (Probably yes.)PossiblyMożliwieMOZH-li-vyehWszystko jest możliwe. (Everything is possible.)ImpossibleNiemożliwenyeh-mozh-LI-vyehTo niemożliwe. (That's impossible.)PossibleMożliwemozh-LI-vyehTo możliwe. (That's possible.)RightPrawo / Prawidłowy / SłusznyPRAH-vo / prah-vee-DWO-vih / SWOOCH-nihMasz rację. (You're right.)WrongZło / Nieprawidłowy / Błędnyzwo / nyeh-prah-vee-DWO-vih / BWEN-dnihMasz błąd. (You're wrong.)CorrectPoprawnypo-PRAHV-nihPoprawna odpowiedź. (Correct answer.)IncorrectNiepoprawnynyeh-po-PRAHV-nihNiepoprawna informacja. (Incorrect information.)GoodDobryDO-brihDobry człowiek. (Good person.)BadZłyzwihZły uczynek. (Bad deed.)MoralMoralnymo-RAHL-nihMoralny dylemat. (Moral dilemma.)ImmoralNiemoralnynyeh-mo-RAHL-nihNiemooralne zachowanie. (Immoral behavior.)EthicalEtycznyeh-TIH-ch-nihEtyczna decyzja. (Ethical decision.)UnethicalNieetycznynyeh-eh-TIH-ch-nihNieetyczne postępowanie. (Unethical conduct.)LegalLegalnyleh-GAHL-nihLegalne działanie. (Legal action.)IllegalNielegalnynyeh-leh-GAHL-nihNielegalne działanie. (Illegal action.)AllowedDozwolonedoz-vo-LO-nehTo jest dozwolone. (This is allowed.)ForbiddenZabronionezah-bro-NEE-onehTo jest zabronione. (This is forbidden.)PermissionPozwoleniepoz-vo-LEN-yehMam pozwolenie. (I have permission.)ProhibitionZakazZAH-kahsZakaz kłamstwa. (Prohibition of lying.)RuleZasadazah-SAH-dahZasada uczciwości. (Rule of honesty.)ExceptionWyjątekvih-YON-tekWyjątek od reguły. (Exception to the rule.)NormNormaNOR-mahSpołeczna norma. (Social norm.)StandardStandardSTAN-dahrtWysoki standard. (High standard.)ExpectationOczekiwanieo-cheh-kee-VAH-nyehTwoje oczekiwania. (Your expectations.)PressurePresjaPREH-shahPresja społeczna. (Social pressure.)StressStresstrehsStres przed kłamstwem. (Stress before lying.)AnxietyLęk / Niepokójwenk / nyeh-PO-kooyLęk przed prawdą. (Anxiety about truth.)ComfortKomfortKOM-fortStrefa komfortu. (Comfort zone.)DiscomfortDyskomfort / Niekonfortdis-KOM-fort / nyeh-kom-FORTPoczucie dyskomfortu. (Feeling of discomfort.)SafetyBezpieczeństwobeh-pyeh-CHEHN-stvoPoczucie bezpieczeństwa. (Feeling of safety.)DangerNiebezpieczeństwonyeh-beh-pyeh-CHEHN-stvoNiebezpieczeństwo prawdy. (Danger of truth.)RiskRyzykoRIH-zih-koRyzyko kłamstwa. (Risk of lying.)RewardNagrodanah-GRO-dahNagroda za prawdę. (Reward for truth.)PunishmentKaraKAH-rahKara za kłamstwo. (Punishment for lying.)ConsequenceKonsekwencjakon-seh-KVEN-tsyaKonsekwencje działania. (Consequences of action.)CausePrzyczynapshih-CHIH-nahPrzyczyna kłamstwa. (Cause of lying.)EffectEfekt / SkutekEH-fekt / SKOO-tekEfekt uboczny. (Side effect.)ReasonPowódPO-vootGłówny powód. (Main reason.)ExcuseWymówkavih-MOOF-kahSłaba wymówka. (Weak excuse.)JustificationUzasadnienieoo-zah-sahd-NYEN-yehUzasadnienie kłamstwa. (Justification of lying.)RationalizationRacjonalizacjarah-tsy-o-nah-li-ZA-tsyaRacjonalizacja zachowania. (Rationalization of behavior.)DenialZaprzeczeniezah-PSHEH-cheh-nyehZaprzeczenie rzeczywistości. (Denial of reality.)ProjectionProjekcjapro-YEK-tsyaProjekcja winy. (Projection of guilt.)RationalizationRacjonalizacjarah-tsy-o-nah-li-ZA-tsyaMechanizm obronny. (Defense mechanism.)PolishEnglishTo jest kłamstwo.This is a lie.Mów prawdę.Speak the truth.Mam zaufanie.I have trust.On kłamie.He is lying.Ukrywam prawdę.I hide the truth.Chronię siebie.I protect myself.Dlaczego kłamiemy?Why do we lie?Jaki powód?What reason?Jaka korzyść?What benefit?Rozumiem dlaczego.I understand why.Wybaczam ci.I forgive you.Ufam ci.I trust you.Prawdziwa twarz.True face.Mechanizm obronny.Defense mechanism.Społeczna norma.Social norm.Presja społeczna.Social pressure.Strefa komfortu.Comfort zone.Osobisty rozwój.Personal growth.Szczera rozmowa.Honest conversation.Czas na zmianę.Time for change.🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

✦ Instagram: https://www.instagram.com/learnpolishpodcast/

Teatro de idiomas

Polish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.instagram.com/teatrodeidiomas/

https://teatrodeidiomas.pl/pl/

I have just launched my PodFather Podcast Coach Community https://www.skool.com/podfather/about

Start your own SKOOl Academy https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

Do you want to unlock your potential?

https://www.skool.com/brainfitness/about

LearnPolish #PolishLanguage #Kłamstwo #Prawda #Lying #Truth #Zaufanie #Trust #Uczciwość #Honesty #PolishVocabulary #BilingualPodcast #PolishEnglish #LanguageLearning #PolishForBeginners #PracticalPolish #LearnPolishPodcast #VaWorld #Psychology #Psychologia #HumanBehavior #ZachowanieCzłowieka #Emocje #Emotions #Obrona #Defense #MechanizmyObronne #DefenseMechanisms #Społeczeństwo #Society #Relacje #Relationships #Komunikacja #Communication #PrawdziwyJa #TrueSelf #Autentyczność #Authenticity #OsobistyRozwój #PersonalGrowth #SzczeraRozmowa #HonestConversation #Zmiana #Change #PolishLessons #SpanishLessons #RealPolish #DeepPolish #PhilosophicalPolish

View Details

This episode explores vocabulary related to appetite (apetyt), food (jedzenie), kitchen routines (rutyny kuchenne), and daily life (codzienne życie) in Polish. We dive into how to discuss hunger, meals, cooking, Netflix habits, and maintaining energy – all in practical, everyday Polish.

Welcome to the Learn Polish Podcast – your immersive gateway to mastering Polish through real conversations, cultural insights, and practical everyday language. Each episode blends authentic Polish dialogue with clear English explanations, helping you build vocabulary naturally while exploring Polish food culture, daily routines, and lifestyle topics. Whether you're a complete beginner or advancing your skills, join us as we make learning Polish engaging, practical, and fun. From appetite (apetyt) to kitchen vocabulary (słownictwo kuchenne), we cover the phrases you actually need for everyday life. Find more episodes, lesson materials, and resources at www.learnpolishpodcast.com. You can also find us on YouTube, Spotify, and Rumble. Looking for virtual assistance, websites, social media, AI agents, or apps? Visit va.world. Need lessons in Polish or Spanish? Check the links in the show notes for both audio and video content.

EnglishPolishPronunciationExample UsageAppetiteApetytah-PEH-titMam apetyt. (I have an appetite.)HungerGłódgwootJestem głodny. (I'm hungry.)FoodJedzenieyeh-DZEN-yehLubię jedzenie. (I like food.)MealPosiłekpo-SHEE-wekTrzy posiłki dziennie. (Three meals a day.)BreakfastŚniadanieshnya-DAH-nyehŚniadanie jest ważne. (Breakfast is important.)LunchObiadOB-yadObiad o dwunastej. (Lunch at twelve.)DinnerKolacja / Obiadko-LA-tsya / OB-yadKolacja o siódmej. (Dinner at seven.)SnackPrzekąskapsheh-KON-skaLekka przekąska. (A light snack.)KitchenKuchniaKOOKH-nyaW kuchni. (In the kitchen.)CookGotowaćgo-TO-vachLubię gotować. (I like to cook.)EatingJedzenieyeh-DZEN-yehJedzenie przy stole. (Eating at the table.)FullPełny / NajedzonyPEW-nih / nah-yeh-DZO-nihJestem pełny. (I'm full.)EmptyPustyPOO-stihPusty talerz. (Empty plate.)PlateTalerzTAH-lehshTalerz zupy. (Plate of soup.)BowlMiskaMEE-skahMiska zbożu. (Bowl of cereal.)CupFiliżanka / Kubekfee-lee-ZHAN-kah / KOO-bekKubek kawy. (A cup of coffee.)GlassSzklankaSHKLAN-kahSzklanka wody. (A glass of water.)WaterWodaVO-dahWoda mineralna. (Mineral water.)CoffeeKawaKAH-vahCzarna kawa. (Black coffee.)TeaHerbataher-BAH-tahHerbata z cytryną. (Tea with lemon.)JuiceSoksokSok pomarańczowy. (Orange juice.)BreadChlebhlepŚwieży chleb. (Fresh bread.)ButterMasłoMAH-swoMasło na chlebie. (Butter on bread.)CheeseSerserSer żółty. (Yellow cheese.)MeatMięsoMYEN-soMięso z warzywami. (Meat with vegetables.)FishRybaRIH-bahRyba na obiad. (Fish for lunch.)VegetablesWarzywavah-ZIH-vahŚwieże warzywa. (Fresh vegetables.)FruitOwoceOH-vo-tsehOwoce sezonowe. (Seasonal fruits.)SaladSałatkasah-WAT-kahSałatka z pomidorów. (Tomato salad.)SoupZupaZOO-pahZupa pomidorowa. (Tomato soup.)DessertDeserDEH-serDeser po obiedzie. (Dessert after lunch.)SweetSłodkiSWOOD-keeSłodki deser. (Sweet dessert.)SaltySłonySWO-nihSłone przekąski. (Salty snacks.)SpicyPikantnypee-KANT-nihPikantne danie. (Spicy dish.)Hot (temperature)Gorącygo-RON-tsihGorąca kawa. (Hot coffee.)ColdZimnyZEEM-nihZimne piwo. (Cold beer.)FreshŚwieżySHFYEH-zhihŚwieże produkty. (Fresh products.)DeliciousPysznyPISH-nihPyszne jedzenie. (Delicious food.)DisgustingObrzydliwyob-zhid-LEE-vihObrzydliwy smak. (Disgusting taste.)NetflixNetflixNET-flixOglądam Netflix. (I watch Netflix.)SeriesSerialSEH-ryahlSerial na Netflixie. (Series on Netflix.)EpisodeOdcinekod-CHEE-nekNowy odcinek. (New episode.)WatchOglądaćog-WON-dachOglądać film. (To watch a movie.)RelaxRelaksować sięre-lak-SO-vach shehCzas na relaks. (Time to relax.)CouchKanapa / Sofakah-NAH-pah / SO-fahLeżeć na kanapie. (Lying on the couch.)EnergyEnergiaeh-ner-GHEE-ahBrak energii. (Lack of energy.)TiredZmęczonyzmen-CHOH-nihJestem zmęczony. (I'm tired.)SleepSensenIdę spać. (I'm going to sleep.)Wake upBudzić sięBOO-dzeech shehBudzę się wcześnie. (I wake up early.)MorningPoranek / Ranopo-RAH-nek / RAH-noWczesny poranek. (Early morning.)EveningWieczórVYEH-choorWieczór przed telewizorem. (Evening in front of TV.)NightNocnotsW nocy. (At night.)DayDzieńdzyenCały dzień. (All day.)TimeCzaschasCzas na obiad. (Time for lunch.)HabitNawykNAH-vikDobry nawyk. (Good habit.)RoutineRutynaroo-TIH-nahCodzienna rutyna. (Daily routine.)ProcessProcesPRO-tsesProces gotowania. (Cooking process.)SystemSystemSIS-temSystem jedzenia. (Eating system.)PositivePozytywnypo-zi-TIV-nihPozytywne nawyki. (Positive habits.)NegativeNegatywnyne-ga-TIV-nihNegatywne skutki. (Negative effects.)ImportantWażnyVAZH-nihWażny posiłek. (Important meal.)ProblemProblemPRO-blemProblem z apetytem. (Problem with appetite.)SolutionRozwiązanieroz-vy-ZA-nyehRozwiązanie problemu. (Solution to the problem.)ChangeZmianaZMYAH-nahZmiana nawyków. (Change of habits.)StartStart / Zacząćstart / ZAH-chonchZacznij od śniadania. (Start with breakfast.)StopStop / Przestaćstop / PSHEH-stachPrzestań jeść. (Stop eating.)ContinueKontynuowaćkon-ty-nu-O-vachKontynuować dietę. (Continue the diet.)SkipPominąć / Ominąćpo-MEE-noch / o-MEE-nochPominąć posiłek. (Skip a meal.)HealthyZdrowyZDRO-vihZdrowe jedzenie. (Healthy food.)UnhealthyNiezdrowynyeh-ZDRO-vihNiezdrowe nawyki. (Unhealthy habits.)DietDietadyeh-TAHByć na diecie. (To be on a diet.)WeightWagaVAH-gahKontrola wagi. (Weight control.)Gain weightPrzytyćpshee-TIHChcę przytyć. (I want to gain weight.)Lose weightSchudnąćSKHOOD-nochChcę schudnąć. (I want to lose weight.)ExerciseĆwiczeniachvee-CHEH-nyaĆwiczenia codziennie. (Exercise every day.)GymSiłownia / Fitnesssee-woov-NYAH / FIT-nesChodzić na siłownię. (Go to the gym.)SportSportsportSport i zdrowie. (Sport and health.)WalkSpacerSPAH-tserSpacer po obiedzie. (Walk after lunch.)RunBiegaćBYEH-gachBiegać rano. (Run in the morning.)SwimPływaćPWIH-vachPływać w basenie. (Swim in the pool.)BikeJeździć na rowerzeYEZH-dzeech nah RO-veh-zehJeździć na rowerze. (Ride a bike.)🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

✦ Instagram: https://www.instagram.com/learnpolishpodcast/

Teatro de idiomas

Polish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.instagram.com/teatrodeidiomas/

https://teatrodeidiomas.pl/pl/

I have just launched my PodFather Podcast Coach Community https://www.skool.com/podfather/about

Start your own SKOOl Academy https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

Do you want to unlock your potential?

https://www.skool.com/brainfitness/about

LearnPolish #PolishLanguage #Apetyt #Appetite #Jedzenie #Food #PolishVocabulary #BilingualPodcast #PolishEnglish #LanguageLearning #PolishForBeginners #PracticalPolish #LearnPolishPodcast #VaWorld #DailyLife #CodzienneZycie #Kuchnia #Kitchen #Gotowanie #Cooking #Netflix #Relaks #Relax #Sniadanie #Breakfast #Obiad #Lunch #Kolacja #Dinner #ZdroweJedzenie #HealthyFood #Nawyki #Habits #Rutyna #Routine #Energia #Energy #Zmeczenie #Tired #PolishLessons #SpanishLessons #RealPolish #EverydayPolish #PolishPhrases #FoodCulture #PolishFood #LifestylePolish

View Details

This episode explores vocabulary related to pathology (patologia), business systems (systemy biznesowe), technology (technologia), and digital operations (operacje cyfrowe) in Polish. We dive into how to discuss problems (problemy), solutions (rozwiązania), networks (sieci), and modern business infrastructure – all in practical, everyday Polish.

Welcome to the Learn Polish Podcast – your immersive gateway to mastering Polish through real conversations, cultural insights, and practical everyday language. Each episode blends authentic Polish dialogue with clear English explanations, helping you build vocabulary naturally while exploring Polish business concepts, technology terms, and modern life topics. Whether you're a complete beginner or advancing your skills, join us as we make learning Polish engaging, practical, and fun. From pathology (patologia) to digital systems (systemy cyfrowe), we cover the phrases you actually need for today's world. Find more episodes, lesson materials, and resources at www.learnpolishpodcast.com. You can also find us on YouTube, Spotify, and Rumble. Looking for virtual assistance? Visit va.world. Join our school groups on Brain Upgrade and podcasting – links in the show notes. Need lessons in Polish or Spanish? Check the links in the description for both audio and video content. Try our free brain upgrade course at school.com/brainupgrade

EnglishPolishPronunciationExample UsagePathologyPatologiapah-to-lo-GHEE-ahTo jest patologia. (This is a mess/pathology.)SystemSystemSIS-temSystem działa. (The system works.)ProblemProblemPRO-blemMamy problem. (We have a problem.)SolutionRozwiązanieroz-vy-ZA-nyehZnajdźmy rozwiązanie. (Let's find a solution.)NetworkSieć / Networkseech / NET-workSieć działa dobrze. (The network works well.)TechnologyTechnologiatek-no-lo-GHEE-ahNowa technologia. (New technology.)DigitalCyfrowytsih-FRO-vihSystem cyfrowy. (Digital system.)BusinessBiznesBEES-nesMój biznes rośnie. (My business is growing.)ProductProduktPRO-duktNowy produkt. (New product.)ServiceUsługaoo-SWOO-gahDobra usługa. (Good service.)AgencyAgencjaah-GEN-tsyaPracuję w agencji. (I work at an agency.)MarketingMarketingMAR-ke-tingMarketing internetowy. (Internet marketing.)TelephoneTelefonteh-LEH-fonZadzwoń na telefon. (Call the phone.)CallPołączenie / Zadzwonićpo-won-CHEN-yeh / zad-ZVO-neechZadzwoń do mnie. (Call me.)ObjectObiekt / ObiektOB-yektJaki to obiekt? (What object is this?)VersionWersjaVER-shahNowa wersja systemu. (New system version.)TargetCel / Targettsel / TAR-getJaki jest cel? (What is the target?)GoalCeltselMój cel to... (My goal is...)BonusBonusBO-nusDostałem bonus. (I got a bonus.)MillionMilionMEE-lyonJeden milion. (One million.)PercentProcentPRO-tsentDziesięć procent. (Ten percent.)StatisticsStatystykasta-TIS-ti-kahStatystyka pokazuje... (Statistics show...)DataDane / DataDAH-neh / DAH-tahAnaliza danych. (Data analysis.)MachineMaszynamah-SHI-nahMaszyna działa. (The machine works.)RobotRobotRO-botRobot automatyzuje. (The robot automates.)AutomationAutomatyzacjaau-to-mah-ti-ZA-tsyaAutomatyzacja procesów. (Process automation.)ApplicationAplikacjaah-plee-KA-tsyaNowa aplikacja. (New application.)SoftwareOprogramowanieo-pro-gra-mo-VAH-nyehNowe oprogramowanie. (New software.)HardwareSprzętSPR-shentNowy sprzęt. (New hardware.)GitHubGitHubGIT-hubKod na GitHubie. (Code on GitHub.)WebsiteStrona internetowaSTRO-nah in-ter-ne-TO-vahMoja strona www. (My website.)DomainDomenado-MEN-nahRejestracja domeny. (Domain registration.)CalendarKalendarzkal-EN-darshSprawdź kalendarz. (Check the calendar.)ScheduleHarmonogram / Grafikhar-mo-NO-gram / GRA-fikJaki jest grafik? (What's the schedule?)EventWydarzenie / Eventvih-dah-ZHEN-yeh / EH-ventOrganizuję event. (I'm organizing an event.)OrganizationOrganizacjaor-ga-nee-ZA-tsyaDobra organizacja. (Good organization.)UnionUnia / ZwiązekOO-nya / ZVYON-zekUnia Europejska. (European Union.)ChangeZmianaZMYAH-nahCzas na zmianę. (Time for change.)SmartSmart / Inteligentnysmart / in-te-li-GENT-nihSmart rozwiązanie. (Smart solution.)PositivePozytywnypo-zi-TIV-nihPozytywne myślenie. (Positive thinking.)LogicLogikalo-GHEE-kahLogika biznesu. (Business logic.)ContextKontekstKON-tekstW kontekście... (In the context of...)AccessDostępDOH-stempMam dostęp. (I have access.)InspectionInspekcja / Kontrolain-SPEK-tsya / kon-TRO-lahInspekcja jakości. (Quality inspection.)QualityJakośćYAH-koshchWysoka jakość. (High quality.)CustomerKlientKLEE-entKlient jest ważny. (The customer is important.)PrivatePrywatnypri-VAT-nihPrywatna firma. (Private company.)PublicPubliczny / Publicznypoo-BLEECH-nihSektor publiczny. (Public sector.)NationalNarodowy / Krajowyna-ro-DO-vih / krai-YO-vihKrajowa sieć. (National network.)InternationalMiędzynarodowymyen-dza-na-ro-DO-vihMiędzynarodowa firma. (International company.)AIAI / Sztuczna inteligencjaah-ee / SHTOOCH-nah in-te-li-GEN-tsyaAI zmienia biznes. (AI is changing business.)UpgradeUpgrade / AktualizacjaUP-grade / ak-tu-a-li-ZA-tsyaCzas na upgrade. (Time for an upgrade.)TrainingTrening / SzkolenieTRE-ning / shko-LEN-yehSzkolenie online. (Online training.)ProcessProcesPRO-tsesProces automatyzacji. (Automation process.)StoreSklep / Magazynsklep / ma-ga-ZINSklep internetowy. (Online store.)SourceŹródłoZWOO-dwoŹródło danych. (Data source.)🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

✦ Instagram: https://www.instagram.com/learnpolishpodcast/

Teatro de idiomas

Polish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.instagram.com/teatrodeidiomas/

https://teatrodeidiomas.pl/pl/

I have just launched my PodFather Podcast Coach Community https://www.skool.com/podfather/about

Start your own SKOOl Academy https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

Do you want to unlock your potential?

https://www.skool.com/brainfitness/about

LearnPolish #PolishLanguage #Patologia #Systemy #Technologia #BusinessPolish #PolishVocabulary #BilingualPodcast #PolishEnglish #LanguageLearning #PolishForBeginners #PracticalPolish #LearnPolishPodcast #VaWorld #Technology #Systems #Automation #AI #DigitalBusiness #NetworkMarketing #Biznes #Rozwiązania #Problemy #Statystyka #GitHub #Robot #Maszyna #Aplikacje #Software #Hardware #Upgrade #Szkolenie #PolishLessons #SpanishLessons #BrainFitness #Podcasting #RealPolish #ProfessionalPolish #TechPolish #NowoczesnyPolski

View Details

Hosts Ania and Roy talk about International Womens Day (March 8), comparing Polish and Irish traditions, gift ideas like flowers and jewelry, and what the day means in modern life.

Hear personal stories, thoughts on gender roles and equality, and warm wishes for women learning Polish. Find episodes and show notes at learnpolishpodcast.com.

"Dzień Kobiet" means "Women's Day," and in this micro-lesson you'll say it like you're handing flowers to every woman you know.First you hear the phrase at native speed, then slowed down so you can master the soft "Dzień" and the flowing "Kobiet."We drop it into three celebration-ready sentences: – "Wszystkiego najlepszego w Dzień Kobiet!" (All the best on Women's Day!) – "Kupiłem kwiaty na Dzień Kobiet." (I bought flowers for Women's Day.) – "To ważne święto w Polsce." (It's an important holiday in Poland.)Repeat-along track included—perfect while you pick tulips or write a card.Challenge: record yourself saying "Dzień Kobiet" and tag us @learnpolishpodcast—we'll repost the sweetest ones!Key Words: English → PolishTableCopyEnglishPolishWomen's DayDzień Kobietflowerskwiatytulipstulipanybest wisheswszystkiego najlepszegoMarch 8thósmy marcagiftprezentchocolateczekoladacelebrateświętowaćimportantważny / ważnaholidayświętomothermatkawifeżonagirlfrienddziewczynacolleaguekoleżankarespectszacuneklovemiłość🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

✦ Instagram: https://www.instagram.com/learnpolishpodcast/

Teatro de idiomas

Polish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.instagram.com/teatrodeidiomas/

https://teatrodeidiomas.pl/pl/

I have just launched my PodFather Podcast Coach Community https://www.skool.com/podfather/about

Start your own SKOOl Academy https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

Do you want to unlock your potential?

https://www.skool.com/brainfitness/about

DzieńKobiet #WomensDay #LearnPolish #PolishLanguage #PolishPodcast

View Details

Welcome to the Learn Polish Podcast – your immersive gateway to mastering Polish through real conversations, cultural insights, and practical everyday language. Each episode blends authentic Polish dialogue with clear English explanations, helping you build vocabulary naturally while exploring Polish traditions, daily life, and essential topics. Whether you're a complete beginner or advancing your skills, join us as we make learning Polish engaging, practical, and fun. From setting goals (cele) to discussing energy (energia) and motivation (motywacja), we cover the phrases you actually need. Find more episodes, lesson materials, and resources at www.learnpolishpodcast.com. You can also find us on YouTube, Spotify, and Rumble. Looking for virtual assistance? Visit va.world. Join our school groups on brainfitness and podcasting – links in the show notes. Need lessons in Polish or Spanish? Check the links in the description for both audio and video content.

This episode dives into essential vocabulary for discussing goals, plans, energy, and motivation in Polish. Perfect for the new year or any fresh start, we explore how to talk about your aspirations, describe your energy levels, and discuss taking action – all in practical, everyday Polish.

ExecutionRealizacja / Wykonaniereh-lee-ZA-tsya / vih-ko-NAH-nyehCzas na realizację. (Time for execution.)NetflixNetflixNET-flixOglądam Netflix. (I watch Netflix.)TikTokTikTokTIK-tokUżywam TikToka. (I use TikTok.)Energy drinkEnergetykeh-ner-GEH-tikPiję energetyka. (I drink an energy drink.)To give upPoddawać siępod-DAH-vach shehNie poddawaj się! (Don't give up!)To keepTrzymaćTSHIH-machTrzymaj się tego! (Stick to it!)To achieveOsiągnąćo-SHONG-nochChcę to osiągnąć. (I want to achieve this.)To changeZmienićZMYEH-neechCzas coś zmienić. (Time to change something.)To moveRuszać / PrzesunąćROO-shach / psheh-SOO-nochMuszę się ruszyć. (I need to move.)To studyStudiować / Uczyć sięstoo-DYO-vach / OO-chih shUczę się polskiego. (I'm learning Polish.)🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

✦ Instagram: https://www.instagram.com/learnpolishpodcast/

Teatro de idiomas

Polish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.instagram.com/teatrodeidiomas/

https://teatrodeidiomas.pl/pl/

I have just launched my PodFather Podcast Coach Community https://www.skool.com/podfather/about

Start your own SKOOl Academy https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

Do you want to unlock your potential?

https://www.skool.com/brainfitness/about

LearnPolish #PolishLanguage #Cele #Goals #Energia #Motywacja #NewYearGoals #PolishVocabulary #BilingualPodcast #PolishEnglish #LanguageLearning #PolishForBeginners #PracticalPolish #LearnPolishPodcast #VaWorld #GoalSetting #Success #Plan #Action #Positive #Motivation #PolishLessons #SpanishLessons #BrainFitness #Podcasting #RealPolish #EverydayPolish #PolishPhrases #StudyPolish #LearnLanguages

View Details

Welcome to the Learn Polish Podcast – your immersive gateway to mastering Polish through real conversations, cultural insights, and practical everyday language. Each episode blends authentic Polish dialogue with clear English explanations, helping you build vocabulary naturally while exploring Polish traditions, holidays, and daily life. Whether you're a complete beginner or advancing your skills, join us as we make learning Polish engaging, practical, and fun. From New Year's Eve celebrations (Sylwester) to casual conversations, we cover the phrases you actually need. Find more episodes, lesson materials, and resources at www.learnpolishpodcast.com. You can also find us on YouTube, Spotify, and Rumble. Looking for virtual assistance? Visit va.world. Join our school groups on Brain Upgrade and Podcasting – links in the show notes. Need lessons in Polish or Spanish? Check the links in the description for both audio and video content.

| Polish | English |
| ------------- | -------------- |
| Sylwester | New Year's Eve |
| fajerwerki | fireworks |
| plan | plan |
| biblia | bible |
| plaża | beach |
| wycieczka | trip/excursion |
| zdrowie | health (toast) |
| szampan | champagne |
| toast | toast/cheers |
| nowy rok | new year |
| cele | goals |
| postanowienia | resolutions |

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

✦ Instagram: https://www.instagram.com/learnpolishpodcast/

Teatro de idiomas

Polish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.instagram.com/teatrodeidiomas/

https://teatrodeidiomas.pl/pl/

I have just launched my PodFather Podcast Coach Community https://www.skool.com/podfather/about

Start your own SKOOl Academy https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

Do you want to unlock your potential?

https://www.skool.com/brainfitness/about

LearnPolish #PolishLanguage #Sylwester #NewYearsEve #PolishHolidays #BilingualPodcast #PolishEnglish #PolishVocabulary #Fajerwerki #NowyRok #PolishTraditions #HolidayVocabulary #Celebrations #ToastInPolish #PolishForBeginners #PolishListening #LanguageLearning #PolishCulture #RealPolish #PracticalPolish #Podcast #LearnPolishPodcast #VaWorld #BrainFitness #Podcasting #PolishLessons #SpanishLessons

View Details

Learn to recognize and discuss toxic relationships in Polish. From "toksyczny jak wąż" (toxic like a snake) to setting boundaries with "To jest moja granica," master essential vocabulary for identifying jealousy, manipulation, and emotional abuse. This episode covers warning signs, healing vocabulary, and assertive phrases to protect yourself. Essential Polish for navigating difficult relationships and prioritizing your wellbeing.

Vocabulary List / Lista słówekTableCopyPolishEnglishPronunciationToksycznyToxictok-SOCH-nihWążSnakevontshZwiązekRelationshipZVYON-zekZazdrosnyJealous (m)zaz-DROS-nihZazdrosnaJealous (f)zaz-DROS-nahKontrolującyControlling (m)kon-tro-loo-YON-tsihManipulacjaManipulationma-nee-poo-LA-tsyaRanaWoundRAH-nahBólPainboolBurzaStormBOO-zhahJadowityVenomousya-do-VEE-tihZdradaBetrayalzdrah-DAHPodłyMean/basePOD-wihPrzemocViolence/abusePZHEH-motsGranicaBoundarygrah-NEE-tsaLeczenieHealingleh-CHEH-nyehTerapiaTherapyteh-RAH-pyahWolnośćFreedomVOL-noshchKoniecEndKOH-nyetsŻegnajGoodbyezheg-NAY🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

✦ Instagram: https://www.instagram.com/learnpolishpodcast/

Teatro de idiomas

Polish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.instagram.com/teatrodeidiomas/

https://teatrodeidiomas.pl/pl/

I have just launched my PodFather Podcast Coach Community https://www.skool.com/podfather/about

Start your own SKOOl Academy https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

Do you want to unlock your potential?

https://www.skool.com/brainfitness/about

Learnpolish #learnpolishpodcast #polishpodcast #LearnPolish #ToxicRelationships #Toksyczny #PolishVocabulary #Boundaries #Jealousy #Manipulation #Healing #RedFlags #MentalHealth

View Details

Welcome to the Learn Polish Podcast – your gateway to mastering Polish through immersive, real-world conversations. Each episode blends authentic Polish dialogue with clear explanations, helping you build vocabulary naturally while exploring Polish culture, traditions, and everyday life. Whether you're a beginner or advancing your skills, join us as we make learning Polish engaging, practical, and fun. Find more episodes, lesson materials, and resources at www.learnpolishpodcast.com. You can also find us on YouTube, Rumble, Spotify, and Bitchute.

Vocabulary List / Lista słówekTableCopyPolishEnglishPronunciationMężczyznaManmensh-CHIZ-nahKobietaWomanko-BYEH-tahZwiązekRelationshipZVYON-zekMarsMarsmarsWenusVenusVEH-noosKomunikacjaCommunicationko-moo-nee-KA-tsyaProblemProblemPRO-blemRozwiązanieSolutionro-zvy-ZA-nyehKonfliktConflictKON-fliktPrzestrzeńSpacepshesh-TRENBańkaBubbleBAHN-kahPrzepraszamI'm sorrypsheh-PRA-shamKompromisCompromisekom-pro-MEESRozumiemI understandro-ZOO-myemNie rozumiemI don't understandnyeh ro-ZOO-myemJestem tu dla ciebieI'm here for youYEH-stem too dla CHEH-byeh🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

✦ Instagram: https://www.instagram.com/learnpolishpodcast/

Teatro de idiomas

Polish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.instagram.com/teatrodeidiomas/

https://teatrodeidiomas.pl/pl/

I have just launched my PodFather Podcast Coach Community https://www.skool.com/podfather/about

Start your own SKOOl Academy https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

Do you want to unlock your potential?

https://www.skool.com/brainfitness/about

Learnpolish #learnpolishpodcast #polishpodcast #LearnPolish #Relationships #MarsVenus #PolishVocabulary #Communication #Love #Dating #PolishCulture #LanguageLearning #JohnGray

View Details

The hosts guide listeners through practical phrases like ordering a kids' meal (menu dziecięce) and asking about toys, but repeatedly breaks the fourth wall to discuss McDonald's "toxic" aspects: low wages, processed ingredients, lobbying power, and its role in global health issues. The episode name-checks competitors (KFC, Subway, Burger King) and touches on institutional investors like BlackRock and Vanguard, framing language learning within a critique of American corporate culture exported globally.

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

✦ Instagram: https://www.instagram.com/learnpolishpodcast/

Teatro de idiomas

Polish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.instagram.com/teatrodeidiomas/

https://teatrodeidiomas.pl/pl/

I have just launched my PodFather Podcast Coach Community https://www.skool.com/podfather/about

Start your own SKOOl Academy https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

Do you want to unlock your potential?

https://www.skool.com/brainfitness/about

Learnpolish #learnpolishpodcast #polishpodcast

View Details

Celebrate Valentine's Day the Polish way. In this episode, we explore essential vocabulary for Walentynki, from romantic expressions to gift-giving phrases. Learn how to say "I love you," discuss teddy bears and chocolates, and navigate Valentine's traditions in Poland. Perfect for beginners and intermediate learners looking to add some love to their Polish skills.

Vocabulary List / Lista słówekPolishEnglishPronunciationWalentynkiValentine's Dayval-en-TEEN-keeMiśTeddy bearmeeshCzekoladkiChocolatesche-ko-LAT-keeKwiatyFlowerskvya-teeRóżeRosesROO-zhePierścionekRingpyersh-CHYO-nekKocham cięI love youKO-ham chyehRandkaDateRANT-kah🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

✦ Instagram: https://www.instagram.com/learnpolishpodcast/

Teatro de idiomas

Polish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.instagram.com/teatrodeidiomas/

https://teatrodeidiomas.pl/pl/

I have just launched my PodFather Podcast Coach Community https://www.skool.com/podfather/about

Start your own SKOOl Academy https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

Do you want to unlock your potential?

https://www.skool.com/brainfitness/about

Learnpolish #learnpolishpodcast #polishpodcast

View Details

Welcome to our Polish Podcast. Hosts Roy and Anja discuss a series of "what if" scenarios — from the collapse of the EU, a third world war, rising pension numbers, human microchips and hidden cancer cures, to space tourism, internet control and home robots.

“Co jeśli” is the Polish way to ask “What if…?”—and in this bite-sized episode you’ll say it like a native day-dreamer.
First you hear the phrase at real speed, then slowed down so you can copy the soft “ć” and the gentle “jeśli.”
We drop it into three imagination-ready sentences:
– “Co jeśli zdam ten egzamin?” (What if I pass this exam?)
– “Co jeśli się pomylę?” (What if I’m wrong?)
– “Co jeśli to zadziała?” (What if it works?)
Repeat-along track included—perfect while you stare out the window or plan your next big move.
Challenge: DM us your boldest Polish “Co jeśli…” question and we’ll answer it in next week’s episode.

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

Teatro de idiomas

Polish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.instagram.com/teatrodeidiomas/

https://teatrodeidiomas.grweb.site/

I have just launched my PodFather Podcast Coach Community https://www.skool.com/podfather/about

Start your own SKOOl Academy https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

Do you want to unlock your potential?

https://www.skool.com/brainfitness/about

Learnpolish #learnpolishpodcast #polishpodcast

View Details

“Boże Narodzenie” is the beautiful (and very Polish) way to say “Christmas,” and in this festive micro-lesson you’ll pronounce it like you’re seated at the wigilia table.
First you hear the phrase at native speed, then slowed down so you can master the nasal “ę” and the soft “ź.”
We drop it into three holiday-ready sentences:
– “Wesołych Świąt!” (Merry Christmas)
– “Spędzam święta z rodziną.” (I’m spending the holidays with family.)
– “Kocham polskie potrawy świąteczne.” (I love Polish Christmas dishes.)
Repeat-along track included—perfect while you wrap gifts or wait for the first star to appear.
Challenge: post a 5-second video of your Christmas tree with the caption “Wesołych Świąt od [your name]” and tag us @learnpolishpodcast—we’ll repost the coziest ones.

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

Teatro de idiomas

Polish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.instagram.com/teatrodeidiomas/

https://teatrodeidiomas.grweb.site/

I have just launched my PodFather Podcast Coach Community https://www.skool.com/podfather/about

Start your own SKOOl Academy https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

Do you want to unlock your potential?

https://www.skool.com/brainfitness/about

Learnpolish #learnpolishpodcast #polishpodcast

View Details

“Stres przed egzaminem” is the Polish way to say “stress before an exam,” and in this micro-lesson you’ll pronounce it without breaking a sweat.
First you hear the phrase at native speed, then slowed down so you can nail the sneaky “sprzed” cluster and the soft “egzaminem.”
We drop it into three calm-down sentences:
– “Czuję stres przed egzaminem.” (I feel stress before the exam.)
– “Muszę odpuścić.” (I need to let go.)
– “Biorę głęboki oddech.” (I take a deep breath.)
Repeat-along track included—perfect while you queue outside the hall or revise in the corridor.
Challenge: DM us your pre-exam Polish mantra and we’ll reply with a 10-second voice cheerleader.

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

Teatro de idiomas

Polish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.instagram.com/teatrodeidiomas/

https://teatrodeidiomas.grweb.site/

I have just launched my PodFather Podcast Coach Community https://www.skool.com/podfather/about

Start your own SKOOl Academy https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

Do you want to unlock your potential?

https://www.skool.com/brainfitness/about

Learnpolish #learnpolishpodcast #polishpodcast

View Details

“Fizyczna atrakcja” is Polish for “physical attraction,” and in this micro-lesson you’ll say it without sounding like a textbook.
First you hear the phrase at native speed, then slowed down so you can nail the soft “fizyczna” and the flowing “atrakcja.”
We drop it into three flirt-ready sentences:
– “Czuję fizyczną atrakcję.” (I feel physical attraction.)
– “Ona jest bardzo atrakcyjna.” (She’s very attractive.)
– “To nie tylko wygląd.” (It’s not just looks.)
Repeat-along track included—perfect while you swipe right or pick an outfit.
Challenge: record a 5-second clip saying “fizyczna atrakcja” with your best smile, tag us @learnpolishpodcast, and we’ll repost our favorites!

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

Teatro de idiomas

Polish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.instagram.com/teatrodeidiomas/

https://teatrodeidiomas.grweb.site/

I have just launched my PodFather Podcast Coach Community https://www.skool.com/podfather/about

Start your own SKOOl Academy https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

Do you want to unlock your potential?

https://www.skool.com/brainfitness/about

Learnpolish #learnpolishpodcast #polishpodcast

View Details

“Organizacja siebie” (“organising yourself”) is the tiny Polish phrase you’ll repeat until your calendar thanks you.
First you hear it at full speed, then slowed down so you can nail the sneaky “cj” and the soft “siebie.”
We drop it into three productivity-ready sentences:
– “Potrzebuję lepszej organizacji siebie.” (I need better self-organisation.)
– “Planuję dzień z rana.” (I plan my day first thing in the morning.)
– “Mój kalendarz jest moim najlepszym przyjacielem.” (My calendar is my best friend.)
Repeat-along track included—perfect while you colour-code your to-do list or batch-cook for the week.
Challenge: post a screenshot of your newly-labelled Polish planner with hashtag #organizacjasiebie and we’ll repost the tidiest one.

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

Teatro de idiomas

Polish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.instagram.com/teatrodeidiomas/

https://teatrodeidiomas.grweb.site/

I have just launched my PodFather Podcast Coach Community https://www.skool.com/podfather/about

Start your own SKOOl Academy https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

Do you want to unlock your potential?

https://www.skool.com/brainfitness/about

Learnpolish #learnpolishpodcast #polishpodcast

View Details

“Wypalenie zawodowe” is how Poles say “job burnout,” and in this micro-lesson you’ll pronounce it without sounding burned-out yourself.
We play the phrase at native speed, slow it down, then slip it into three office-ready sentences:
– “Czuję wypalenie zawodowe.” (I feel job burnout.)
– “Potrzebuję przerwy.” (I need a break.)
– “Równowaga jest ważna.” (Balance is important.)
Repeat-along track included—perfect on the commute home or during a five-minute screen-free breather.
Challenge: DM us one Polish word that calms you down and we’ll send back a 10-second voice chill-pill.

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

Teatro de idiomas

Polish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.instagram.com/teatrodeidiomas/

https://teatrodeidiomas.grweb.site/

I have just launched my PodFather Podcast Coach Community https://www.skool.com/podfather/about

Start your own SKOOl Academy https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

Do you want to unlock your potential?

https://www.skool.com/brainfitness/about

Learnpolish #learnpolishpodcast #polishpodcast

View Details

“Uzależnienie od alkoholu” is Polish for “alcohol addiction,” and in this micro-lesson you’ll say it clearly, without stigma or stumble.
First you hear the full phrase at native speed, then slowed down so you can master the tricky “ź” and the nasal “ę.”
We slip it into three supportive, real-life sentences:
– “Szukam pomocy.” (I’m looking for help.)
– “To nie Twoja wina.” (It’s not your fault.)
– “Każdy dzień bez alkoholu to sukces.” (Every day without alcohol is a success.)
Repeat-along track included—listen privately or share with someone who needs it.
Challenge: if today is your day one, DM us “dzień pierwszy” in Polish and we’ll send back a personalized “jestem z Tobą” voice note.

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

Teatro de idiomas

Polish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.instagram.com/teatrodeidiomas/

https://teatrodeidiomas.grweb.site/

I have just launched my PodFather Podcast Coach Community https://www.skool.com/podfather/about

Start your own SKOOl Academy https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

Do you want to unlock your potential?

https://www.skool.com/brainfitness/about

Learnpolish #learnpolishpodcast #polishpodcast

View Details

“Prace” means both “jobs” and “work,” and in this micro-lesson you’ll say it like you’re scanning the Polish classifieds.
We play the word at real speed, slow it down, then slot it into three CV-ready sentences:
– “Szukam nowych prac.” (I’m looking for new jobs.)
– “Ta praca jest zdalna.” (This job is remote.)
– “Roboty zabierają niektóre prace.” (Robots are taking some jobs.)
Repeat-along track included—perfect while you update LinkedIn or queue for the unemployment office.
Challenge: tweet your dream Polish job title with hashtag #mojaprace and tag us @learnpolishpodcast—we’ll reply with the correct genitive form.

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

Teatro de idiomas

Polish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.instagram.com/teatrodeidiomas/

https://teatrodeidiomas.grweb.site/

I have just launched my PodFather Podcast Coach Community https://www.skool.com/podfather/about

Start your own SKOOl Academy https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

Do you want to unlock your potential?

https://www.skool.com/brainfitness/about

Learnpolish #learnpolishpodcast #polishpodcast

View Details

“Zwierzęta domowe” means “house animals,” and in this bite-sized episode you’ll pronounce it like a vet from Warsaw.
First you hear the phrase at full speed, then slowed down so you can master the sneaky “ę” and the soft “ź.”
We drop it into three pet-proof sentences:
– “Mam dwa zwierzęta domowe.” (I have two house pets.)
– “Kocham mojego kota.” (I love my cat.)
– “Proszę, nie wchodź na kanapę!” (Please, don’t get on the couch)
Repeat-along track included—perfect while you refill the water bowl or hunt for the laser pointer.
Challenge: post a 5-second video of your pet with the Polish caption “To moje zwierzę domowe” and tag us @learnpolishpodcast—we’ll share our favorites.

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

Teatro de idiomas

Polish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.instagram.com/teatrodeidiomas/

https://teatrodeidiomas.grweb.site/

I have just launched my PodFather Podcast Coach Community https://www.skool.com/podfather/about

Start your own SKOOl Academy https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

Do you want to unlock your potential?

https://www.skool.com/brainfitness/about

Learnpolish #learnpolishpodcast #polishpodcast

View Details

“Gry w kałamarnicę” is how Poles refer to the global hit “Squid Games,” and in this micro-lesson you’ll pronounce it like you just stepped off the set.
First you hear the phrase at full speed, then slowed down so you can master the twisty “ł” and the soft “nicę.”
We drop it into three binge-ready sentences:
– “Oglądałeś Gry w kałamarnicę?” (Have you watched Squid Games?)
– “To jest tylko gra.” (It’s only a game.)
– “Nie umiem rysować tamtego symbolu.” (I can’t draw that symbol.)
Repeat-along track included—perfect while you queue the next episode or sketch a honeycomb.
Challenge: DM us the Polish name of the game you think you’d survive and we’ll reply with your odds in Polish.

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

Teatro de idiomas

Polish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.instagram.com/teatrodeidiomas/

https://teatrodeidiomas.grweb.site/

I have just launched my PodFather Podcast Coach Community https://www.skool.com/podfather/about

Start your own SKOOl Academy https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

Do you want to unlock your potential?

https://www.skool.com/brainfitness/about

Learnpolish #learnpolishpodcast #polishpodcast

View Details

“Zima” is Polish for “winter,” and in this micro-lesson you’ll say it so well that even the snowflakes listen.
First you hear the word at street speed, then slowed down so you can copy the short, punchy “i.”
We drop it into three frosty, ready-to-use sentences:
– “Lubię zimę.” (I like winter.)
– “Pada śnieg!” (It’s snowing!)
– “Trzeba odgarnąć śnieg.” (You have to shovel the snow.)
Repeat-along track included—perfect while you scrape ice off the windshield or sip hot tea.
Challenge: record a 5-second clip of yourself saying “Zima nadchodzi!” (Winter is coming!) and tag us @learnpolishpodcast; we’ll repost the coolest ones.

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

Teatro de idiomas

Polish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.instagram.com/teatrodeidiomas/

https://teatrodeidiomas.grweb.site/

I have just launched my PodFather Podcast Coach Community https://www.skool.com/podfather/about

Start your own SKOOl Academy https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

Do you want to unlock your potential?

https://www.skool.com/brainfitness/about

Learnpolish #learnpolishpodcast #polishpodcast

View Details

“Chwytaj dzień” is the Polish way of saying “Carpe Diem – seize the day,” and in this micro-lesson you’ll pronounce it like someone who actually does.
We play the phrase at real speed, slow it down, then drop it into three ready-to-use sentences:
– “Postanowiłem chwytaj dzień.” (I decided to seize the day.)
– “Nie czekaj, chwytaj dzień!” (Don’t wait, seize the day!)
– “Każdy dzień jest szansą.” (Every day is a chance.)
Repeat-along track included—perfect for your morning alarm or pre-workout playlist.
Challenge: DM us one thing you’ll do today to “chwytaj dzień” in Polish and we’ll reply with a personalized cheer.

View Details

“Urodziny” means “birthday,” and in this micro-lesson you’ll say it like you’ve been invited to the party since childhood.
We give you the word at natural speed, then slow it down so you can nail the stress on the second syllable.
After that we glue it into three must-know lines:
– “Wszystkiego najlepszego!” (All the best!)
– “Dziękuję za prezent.” (Thanks for the gift.)
– “Mam dzisiaj urodziny.” (It’s my birthday today.)
Repeat-along track included—perfect to whisper while blowing out candles or typing “🎉” in chat.
Challenge: record yourself singing the Polish “Sto lat” birthday song and tag us @learnpolishpodcast—we’ll repost our favorites.

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

Teatro de idiomas

Polish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.instagram.com/teatrodeidiomas/

https://teatrodeidiomas.grweb.site/

I have just launched my PodFather Podcast Coach Community https://www.skool.com/podfather/about

Start your own SKOOl Academy https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

Do you want to unlock your potential?

https://www.skool.com/brainfitness/about

Learnpolish #learnpolishpodcast #polishpodcast

View Details

This bite-sized episode is all about “pielęgnacja skóry” – skin care.
First you’ll hear the phrase at full speed, then slowed down so you can mimic the Polish melody.
We stitch it into three ultra-useful lines you can drop into any chat:
– “Dbam o moją skórę.” (I take care of my skin.)
– “Jaki masz krem?” (What cream do you use?)
– “To jest tylko marketing.” (It’s just marketing.)
Repeat track included – perfect for your morning routine while you slap on whatever’s in your bathroom cabinet.
Challenge: describe your own skin-care steps in Polish before the episode ends and post it in the comments – we’ll correct the first ten.

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

Teatro de idiomas

Polish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.instagram.com/teatrodeidiomas/

https://teatrodeidiomas.grweb.site/

I have just launched my PodFather Podcast Coach Community https://www.skool.com/podfather/about

Start your own SKOOl Academy https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

Do you want to unlock your potential?

https://www.skool.com/brainfitness/about

Learnpolish #learnpolishpodcast #polishpodcast

View Details

“Gra na telefonie” is the tiny Polish sentence you’ll hear a dozen times in this lesson.
It means “playing on the phone,” and once you can say it naturally you’ll understand half of what Polish parents mumble at their kids.
We slow the phrase down, speed it back up, then drop it into real-life snippets:
– “Nie graj na telefonie!” (Stop playing on the phone!)
– “Gram tylko pięć minut.” (I’m only playing five minutes.)
Repeat-out-loud track included, so practice on your commute and surprise the next Polish speaker you meet.
Fun challenge: count how many times you catch yourself gaming on your own phone before the episode ends.

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

Teatro de idiomas

Polish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.instagram.com/teatrodeidiomas/

https://teatrodeidiomas.grweb.site/

I have just launched my PodFather Podcast Coach Community https://www.skool.com/podfather/about

Start your own SKOOl Academy https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

Do you want to unlock your potential?

https://www.skool.com/brainfitness/about

Learnpolish #learnpolishpodcast #polishpodcast

View Details

In this short, high-energy episode we flip the usual script and ask: Can you cook?
Listen for the Polish question “Czy potrafisz gotować?” repeated in real-life speed, then slowed down so you can copy the accent. We toss in handy extras: “I like to cook – Lubię gotować,” “I’m learning – Uczę się,” and the magic word that gets you invited to every Polish dinner table, “Pomogę – I’ll help.”
By the end you’ll be able to answer the title question with confidence (even if the only thing you can make is coffee).
Do us a favor: try the new phrase on a Polish friend today and tag us @learnpolishpodcast – we love re-posting your victories. 🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

Teatro de idiomas

Polish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.instagram.com/teatrodeidiomas/

https://teatrodeidiomas.grweb.site/

I have just launched my PodFather Podcast Coach Community https://www.skool.com/podfather/about

Start your own SKOOl Academy https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

Do you want to unlock your potential?

https://www.skool.com/brainfitness/about

Learnpolish #learnpolishpodcast #polishpodcast

View Details

Welcome to Learn Polish Podcast. In this episode we dive into Instagram’s evolution from a photo-sharing app to a reels-driven, ad-filled platform — exploring algorithms, bots, influencer culture, and how social media turns time into money. We discuss manipulation, signs you’re spending too much time online, the benefits and pitfalls for business and podcasting, and practical tips for a social media detox.

Find all episodes at learnpolishpodcast.com and on Bitchute, YouTube, Rumble and Spotify. For links to podcast coaching, virtual assistants (va.world), Polish and Spanish lessons with Ania, and more about the host, scan the QR code or visit www.roycoughlan.com — see the show notes for details.

I have just launched my PodFather Podcast Coach Community https://www.skool.com/podfather/about

Start your own SKOOl Academy https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

Do you want to unlock your potential?

https://www.skool.com/brainfitness/about

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

Teatro de idiomas

Polish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.instagram.com/teatrodeidiomas/

https://teatrodeidiomas.grweb.site/

Learnpolish #learnpolishpodcast #polishpodcast

View Details

Welcome to Learn Polish Podcast. You can find all our episodes on learnpolishpodcast.com. This episode explores Poland's Independence Day (11 November) through a conversation with Roy, who reflects on 18 years living in Poland.

Roy discusses big changes he has seen — improved infrastructure, new lifestyles and diets, evolving public culture, and the importance of safety and family traditions. The hosts also touch on Poland's history, the legacy of communism, and what freedom means to different generations.

For language learners, Ania offers Polish and Spanish lessons—links are in the show notes. Find more about the show and resources, including how to contact Roy, in the episode notes and video description.

I have just launched my PodFather Podcast Coach Community https://www.skool.com/podfather/about

Start your own SKOOl Academy https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

Do you want to unlock your potential?

https://www.skool.com/brainfitness/about

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

Teatro de idiomas

Polish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.instagram.com/teatrodeidiomas/

https://teatrodeidiomas.grweb.site/

Learnpolish #learnpolishpodcast #polishpodcast

View Details

In this episode of the Learn Polish Podcast Ania and Ania chat informally about smoking habits in Poland — comparing cigarettes, shisha (hookah) and electronic alternatives. They discuss flavors, social rituals, personal memories and common health concerns, with light humor and everyday vocabulary for learners.

Find episode references and links at learnpolishpodcast.com; lessons from Ania (Polish/Spanish) are in the show notes. For more about the host and services scan the QR code or visit www.roycoughlan.com and va.world.

I have just launched my PodFather Podcast Coach Community https://www.skool.com/podfather/about

Start your own SKOOl Academy https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

Do you want to unlock your potential?

https://www.skool.com/brainfitness/about

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

Teatro de idiomas

Polish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.instagram.com/teatrodeidiomas/

https://teatrodeidiomas.grweb.site/

Learnpolish #learnpolishpodcast #polishpodcast

View Details

In this episode of Learn Polish Podcast hosts Anja and Roy discuss karma — is it a moral law, a life cause-and-effect, or tied to reincarnation? They share personal stories, question modern uses of the word, and reflect on how daily choices shape outcomes.

Find full show notes and links to lessons in Polish and Spanish at learnpolishpodcast.com; for more about the hosts and resources scan the QR code or visit www.roycoughlan.com and VA.world.

I have just launched my PodFather Podcast Coach Community https://www.skool.com/podfather/about

Start your own SKOOl Academy https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

Do you want to unlock your potential?

https://www.skool.com/brainfitness/about

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

Teatro de idiomas

Polish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.instagram.com/teatrodeidiomas/

https://teatrodeidiomas.grweb.site/

Learnpolish #learnpolishpodcast #polishpodcast

View Details

In this episode of Learn Polish Podcast the hosts debate whether determination is an innate talent or a skill you can develop. They share personal business stories, setbacks and recoveries, and practical tips — lists, coaching, routines and intuition — to build long-term discipline.

The conversation also covers how to avoid unhealthy obsession, balance work and rest, and why your circle influences your habits. Find all episodes and links in the show notes at learnpolishpodcast.com.

I have just launched my PodFather Podcast Coach Community https://www.skool.com/podfather/about

Start your own SKOOl Academy https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

Do you want to unlock your potential?

https://www.skool.com/brainfitness/about

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

Teatro de idiomas

Polish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.instagram.com/teatrodeidiomas/

https://teatrodeidiomas.grweb.site/

Learnpolish #learnpolishpodcast #polishpodcast

View Details

Welcome to Learn Polish Podcast, episode number 542. In this episode the hosts talk about Halloween in Poland, its Irish origins, and how pumpkins replaced turnips as global symbols.

They discuss the holiday’s growing popularity in cities, the contrast with All Saints’ Day, children’s parties and trick-or-treating, and debate whether Halloween is a fun tradition or commercialized import affecting Polish culture.

I have just launched my PodFather Podcast Coach Community https://www.skool.com/podfather/about

Start your own SKOOl Academy https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

Do you want to unlock your potential?

https://www.skool.com/brainfitness/about

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

Teatro de idiomas

Polish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.instagram.com/teatrodeidiomas/

https://teatrodeidiomas.grweb.site/

Learnpolish #learnpolishpodcast #polishpodcast

View Details

Welcome to Learn Polish Podcast, episode number 541. You can find all our episodes on learnpolishpodcast.com. You'll get lessons from Ania in Spanish or in Polish.

Find our links in the show notes and on the audio and video. Find everything about me by scanning the QR code or visiting roycoughlan.com. If you're looking for virtual assistance, go to va.world.

In this episode Roy and Ania share personal experiences dealing with Polish urzędy, discuss bureaucracy, legal worries, and the progress of digitalization and digital IDs. They compare systems abroad, offer frustrations and suggestions for improvement, and invite listeners to share their own stories.

I have just launched my PodFather Podcast Coach Community https://www.skool.com/podfather/about

Start your own SKOOl Academy https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

Do you want to unlock your potential?

https://www.skool.com/brainfitness/about

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

Teatro de idiomas

Polish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.instagram.com/teatrodeidiomas/

https://teatrodeidiomas.grweb.site/

Learnpolish #learnpolishpodcast #polishpodcast

View Details

Welcome to episode number #540of Learn Polish Podcast which is #20 Re-Mastered. Roy and Kamila practice Polish numbers, counting, and basic math vocabulary including plus, minus, times and divide. They cover numbers from zero up to millions, practice arithmetic (addition, subtraction, multiplication, division), and touch on pronunciation tips like rolling the R. This episode is a short, practical lesson for learners who want to strengthen number skills and everyday math terms in Polish.

I have just launched my PodFather Podcast Coach Community https://www.skool.com/podfather/about

Start your own SKOOl Academy https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

Do you want to unlock your potential?

https://www.skool.com/brainfitness/about

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

Teatro de idiomas

Polish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.instagram.com/teatrodeidiomas/

https://teatrodeidiomas.grweb.site/

Learnpolish #learnpolishpodcast #polishpodcast

View Details

In episode 539 of Learn Polish Podcast, Roy and Ania discuss honesty—what it means, white lies versus brutal truth, and how sincerity affects friendships, relationships and self-awareness.

They share personal examples about trust, boundaries, and when honesty can help or harm a relationship.

Find full episodes at learnpolishpodcast.com and links to the video and audio platforms in the show notes.

I have just launched my PodFather Podcast Coach Community https://www.skool.com/podfather/about

Start your own SKOOl Academy https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

Do you want to unlock your potential?

https://www.skool.com/brainfitness/about

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

Teatro de idiomas

Polish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.teatrodeidiomas.pl/pl/

https://www.instagram.com/teatrodeidiomas/

https://teatrodeidiomas.grweb.site/

Learnpolish #learnpolishpodcast #polishpodcast

View Details

Episode 19: Roy (student) and Kamila (teacher) cover Polish clothing vocabulary (ubrania) — koszula, spodnie, bluzka, sukienka, buty and more — and practice phrases like "Mam na sobie" to say what you are wearing.

The conversation includes colors, seasonal items (czapka, szalik, rękawiczki), differences between shoes and boots, and women's items such as spódnica and rajstopy, with simple examples and repetition.

For more information or contact, visit roycolin.com. The episode also mentions speakingpodcast.com and meditationpodcast.org for related topics.

I have just launched my PodFather Podcast Coach Community https://www.skool.com/podfather/about

Start your own SKOOl Academy https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

Do you want to unlock your potential?

https://www.skool.com/brainfitness/about

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

Teatro de idiomas

Polish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.teatrodeidiomas.pl/pl/

https://www.instagram.com/teatrodeidiomas/

https://www.facebook.com/people/Teatro-de-idiomas/61573960503867/

Learnpolish #learnpolishpodcast #polishpodcast

View Details

Welcome to Learn Polish Podcast, episode 537. Hosts Ania and Roy discuss attitudes toward money, budgeting, saving, impulse buying versus planning, cash versus cards, investing, and how money can affect people.

They share personal stories about first purchases, family lessons, teaching children financial responsibility, and practical tips for monthly planning and using cards wisely.

Find other episodes on learnpolishpodcast.com or on YouTube, Rumble and Spotify. Lessons are available in Polish and Spanish; links and a QR code are in the show notes, along with information about the Brain Fitness and Podfather school groups.

I have just launched my PodFather Podcast Coach Community https://www.skool.com/podfather/about

Start your own SKOOl Academy https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

Do you want to unlock your potential?

https://www.skool.com/brainfitness/about

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

Teatro de idiomas

Polish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.instagram.com/teatrodeidiomas/

https://www.facebook.com/people/Teatro-de-idiomas/61573960503867/

Learnpolish #learnpolishpodcast #polishpodcast

View Details

Welcome to Learn Polish Podcast, episode 536 — "Pinset Suggesti Sest." Hosts discuss stress: defining it, personal first experiences, bodily signals, and when stress can be motivating. They share practical coping strategies like breathing exercises, short meditations, hobbies, movement, and acceptance. Roy's story about a Valencia theft illustrates managing stress during travel. Find lessons, show notes, and links at learnpolishpodcast.com and roycoughlan.com

I have just launched my PodFather Podcast Coach Community https://www.skool.com/podfather/about

Start your own SKOOl Academy https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

Do you want to unlock your potential?

https://www.skool.com/brainfitness/about

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

Teatro de idiomas

Polish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.instagram.com/teatrodeidiomas/

https://www.facebook.com/people/Teatro-de-idiomas/61573960503867/

Learnpolish #learnpolishpodcast #polishpodcast

View Details

Episode 18 of Learn Polish Podcast with Roy and teacher Kamila. They practice common banking vocabulary and short dialogues, including going to the bank (Idę do banku), opening and closing accounts, making transfers (zrobić przelew), deposits and withdrawals, and using an ATM.

This short lesson helps learners rehearse useful phrases for real-life banking situations and includes role-play dialogs to practice pronunciation and sentence structure.

I have just launched my PodFather Podcast Coach Community https://www.skool.com/podfather/about

Start your own SKOOl Academy https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

Do you want to unlock your potential?

https://www.skool.com/brainfitness/about

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

Teatro de idiomas

Polish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.instagram.com/teatrodeidiomas/

https://www.facebook.com/people/Teatro-de-idiomas/61573960503867/

Learnpolish #learnpolishpodcast #polishpodcast

View Details

Welcome to Learn Polish Podcast, Episode 534 with Roy and Ania. They chat about vacations, first trips, spontaneous versus organized travel, and memorable experiences in Spain, Thailand, and Brazil. The episode explores how travel can challenge stereotypes, shape personal growth, and offer surprising cultural lessons.

They share practical tips on safety and packing (passport, money, clothes) and point listeners to lessons with Ania, show notes, QR codes, and resources for starting a podcast or finding a virtual assistant. Dziękuję bardzo i do widzenia.

I have just launched my PodFather Podcast Coach Community https://www.skool.com/podfather/about

Start your own SKOOl Academy https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

Do you want to unlock your potential?

https://www.skool.com/brainfitness/about

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

Teatro de idiomas

Polish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.instagram.com/teatrodeidiomas/

https://www.facebook.com/people/Teatro-de-idiomas/61573960503867/

Learnpolish #learnpolishpodcast #polishpodcast

View Details

Welcome to LearnPolishPodcast. You can find all our episodes on LearnPolishPodcast.com, from YouTube and Rumble and Spotify. If you want lessons from Anja in Polish or Spanish, you can find the links in the show notes and you find everything about me on roycoughlan.com, scan the QR code and if you want virtual assistance, go to VA.world.

In this episode Ania and Roy explore the complexities of friendship: limits, silence, drifting apart, and when to repair or end relationships. Using everyday examples and characters like Zosia and Krzysio, they discuss personal growth, boundaries, confronting harmful behavior, and how to choose who stays in your life.

I have just launched my PodFather Podcast Coach Community https://www.skool.com/podfather/about

Start your own SKOOl Academy https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

Teatro de idiomas

Polish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.instagram.com/teatrodeidiomas/

https://www.facebook.com/people/Teatro-de-idiomas/61573960503867/

Learnpolish #learnpolishpodcast #polishpodcast

View Details

In this episode Roy and teacher Kamila walk through useful post office vocabulary and common phrases in Polish — words like poczta, koperta, znaczek — and how to ask about costs, send letters, and collect parcels.

They also practice short dialogues you can use at the post office, including buying stamps, describing envelope sizes, and paying by cash or card.

I have just launched my PodFather Podcast Coach Community https://www.skool.com/podfather/about

Start your own SKOOl Academy https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

Teatro de idiomas

Polish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.instagram.com/teatrodeidiomas/

https://www.facebook.com/people/Teatro-de-idiomas/61573960503867/

Learnpolish #learnpolishpodcast #polishpodcast

View Details

Welcome to Learn Polish Podcast. In this episode Ania and Roy share personal memories of school and discuss how education could be reformed — covering strict teaching methods, the focus on memorization and exams, the value of practical life skills, homeschooling, hybrid learning, and how AI might change the teacher's role.

You can find all episodes at learnpolishpodcast.com and on Bitchute, YouTube and Rumble. Lessons with Ania are available in Polish or Spanish; links are in the show notes. Scan the QR code or visit roikon.com to see my six podcasts, podcast coaching and school group, and go to VA.world for virtual assistant services.

I have just launched my PodFather Podcast Coach Community https://www.skool.com/podfather/about

Start your own SKOOl Academy https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

Teatro de idiomas

Polish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.instagram.com/teatrodeidiomas/

https://www.facebook.com/people/Teatro-de-idiomas/61573960503867/

Learnpolish #learnpolishpodcast #polishpodcast

View Details

In this episode hosts Ania and Roy discuss the Łódź housing market and everyday choices about living situations: city center versus suburbs, renting versus owning, living alone or with roommates, and the importance of rental agreements.

They also cover practical topics like price versus standard, dealing with neighbours, pets, balconies, and the Polish saying “ciasne, ale własne” (small but your own).

I have just launched my PodFather Podcast Coach Community https://www.skool.com/podfather/about

Start your own SKOOl Academy https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

Teatro de idiomas

Polish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.instagram.com/teatrodeidiomas/

https://www.facebook.com/people/Teatro-de-idiomas/61573960503867/

Learnpolish #learnpolishpodcast #polishpodcast

View Details

Join Roy and teacher Kamala as they practice common Polish professions and the key question "Kim jesteś z zawodu?" The episode covers vocabulary like nauczycielka (teacher), lekarz (doctor), biznesmen (businessman), and more, with example sentences and pronunciation practice.

Listen for short dialogues about work, running a company, and simple questions you can use to ask someone about their job in Polish.

I have just launched my PodFather Podcast Coach Community https://www.skool.com/podfather/about

Start your own SKOOl Academy https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

Teatro de idiomas

Polish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.instagram.com/teatrodeidiomas/

https://www.facebook.com/people/Teatro-de-idiomas/61573960503867/

Learnpolish #learnpolishpodcast #polishpodcast

View Details

In this episode Ania chats with Roy about dreams — from strange, funny, and nonsensical dreams to nightmares, sleep paralysis, sleepwalking, lucid dreaming, talking in your sleep, and déjà vu. They share personal stories and reflect on how films, worries, and daily life influence our nights.

They also touch on horoscopes and zodiac traits, the idea of astral projection, and the importance of good sleep for health and regeneration. The conversation is informal, humorous, and full of relatable moments.

Welcome to Learn Polish Podcast. You can find other episodes on learnpolishpodcast.com. You can get lessons from Ania. Whether you want to learn Polish or Spanish, check the show notes for links to YouTube, Rumble, Spotify (audio and video), and scan the QR code for more.

I have just launched my PodFather Podcast Coach Community https://www.skool.com/podfather/about

Start your own SKOOl Academy https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

Teatro de idiomas

Polish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.instagram.com/teatrodeidiomas/

https://www.facebook.com/people/Teatro-de-idiomas/61573960503867/

Learnpolish #learnpolishpodcast #polishpodcast

View Details

In this episode of Learn Polish Podcast Roy and Ania talk about work: first jobs, what makes a job enjoyable, dealing with difficult bosses and coworkers, and how work can change you. They share personal stories—from pub shifts and lawnmowing to managing teams and a funny fire-extinguisher prank—plus practical advice on staying motivated and growing your skills.

Welcome to Learn Polish Podcast. You can find all our episodes on learnpolishpodcast.com. For lessons from Anya check the show notes; find Roy at www.roycoughlan.com, virtual assistance services at va.world, and podcaster school info in the podcast description.

I have just launched my PodFather Podcast Coach Community https://www.skool.com/podfather/about

Start your own SKOOl Academy https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

Teatro de idiomas

Polish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.instagram.com/teatrodeidiomas/

https://www.facebook.com/people/Teatro-de-idiomas/61573960503867/

Learnpolish #learnpolishpodcast #polishpodcast

View Details

Episode 15 of Learn Polish Podcast features Roy and teacher Kamilla practicing the questions "Dokąd idziesz?" and "Na co idziesz?" while naming common places like the shop, restaurant, café, cinema, theatre, park, museum, opera and school.

Listen for example sentences and useful vocabulary for everyday activities—shopping, eating, drinking coffee, watching films and attending concerts—to help you speak basic Polish in daily situations.

I have just launched my PodFather Podcast Coach Community https://www.skool.com/podfather/about

Start your own SKOOl Academy https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

Teatro de idiomas

Polish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.instagram.com/teatrodeidiomas/

https://www.facebook.com/people/Teatro-de-idiomas/61573960503867/

Learnpolish #learnpolishpodcast #polishpodcast

View Details

Welcome to Learn Polish Podcast episode 525. Ania and Roy discuss life in the city (with a focus on Łódź) versus life in the village, sharing personal experiences from Poland, Ireland, and dreams of living by the sea in Spain.

They compare transport, nightlife, community, noise, safety, food quality and convenience, and share personal preferences: Roy favors village life for peace and nature, while Ania values the city’s activities and amenities.

I have just launched my PodFather Podcast Coach Community https://www.skool.com/podfather/about

Start your own SKOOl Academy https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

Teatro de idiomas

Polish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.instagram.com/teatrodeidiomas/

https://www.facebook.com/people/Teatro-de-idiomas/61573960503867/

Learnpolish #learnpolishpodcast #polishpodcast

View Details

Welcome to Learn Polish Podcast, episode number 524. You'll find other episodes on learnpolishpodcast.com, on YouTube, Rumble and Spotify. Scan the QR code or go to www.roughlan.com to find six shows and everything I'm doing in podcasting. Lessons from Ania are available in the show notes, audio and video.

In this episode Ania and Roy discuss shopping — trips to malls and weekly grocery runs, impulse buys versus planned purchases, price and promotion psychology, online vs in-store shopping, social media influence, and whether shopping can act as therapy. They share simple tips to tell a need from a want, how to avoid regret, and ideas like donating excess clothes.

I have just launched my PodFather Podcast Coach Community https://www.skool.com/podfather/about

Start your own SKOOl Academy https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

Teatro de idiomas

Polish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.instagram.com/teatrodeidiomas/

https://www.facebook.com/people/Teatro-de-idiomas/61573960503867/

Learnpolish #learnpolishpodcast #polishpodcast

View Details

Welcome to episode 14 of Learn Polish Podcast. Hosts Roy and Kamila focus on travelling (podróże), teaching the verb “podróżować”, common questions (Czy lubisz podróżować? Z kim? Kiedy?) and useful travel phrases.

The episode features pronunciation practice, sample answers about destinations and activities, and tips for using Polish while traveling. Ideal for beginner to intermediate learners.

I have just launched my PodFather Podcast Coach Community https://www.skool.com/podfather/about

Start your own SKOOl Academy https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

Teatro de idiomas

Polish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.instagram.com/teatrodeidiomas/

https://www.facebook.com/people/Teatro-de-idiomas/61573960503867/

Learnpolish #learnpolishpodcast #polishpodcast

View Details

In episode 522 Roy and Ania discuss how technology and social media shape our daily lives and relationships. They explore phone habits, algorithms and bots, virtual versus real-life connections, and how notifications and scrolling affect attention and wellbeing.

The hosts use a short quiz to examine phone dependence, share personal examples, and encourage listeners to find balance and greater control over their tech use.

I have just launched my PodFather Podcast Coach Community https://www.skool.com/podfather/about

Start your own SKOOl Academy https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

Teatro de idiomas

Polish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.instagram.com/teatrodeidiomas/

https://www.facebook.com/people/Teatro-de-idiomas/61573960503867/

Learnpolish #learnpolishpodcast #polishpodcast

View Details

Episode 521 of Learn Polish Podcast: hosts Roy and Ania talk about dating (randka) — first impressions, conversation chemistry, awkward moments, and how to spot red flags.

They discuss practical topics like restaurant vs. walk dates, where to meet, what to wear, who pays, balancing shared hobbies vs. emotional connection, and how to deal with ghosting in modern dating.

I have just launched my PodFather Podcast Coach Community https://www.skool.com/podfather/about

Start your own SKOOl Academy https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

Teatro de idiomas

Polish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.instagram.com/teatrodeidiomas/

https://www.facebook.com/people/Teatro-de-idiomas/61573960503867/

Learnpolish #learnpolishpodcast #polishpodcast

View Details

In this episode Ania and Roy talk about everyday habits — the good, the bad and the quirky — how they shape our mood and routines. They share coping strategies for low days, the importance of balance, affirmations, and simple habits like exercise, coffee rituals and family time, mixing Polish and English in a friendly conversation.

Find all episodes at learnpolishpodcast.com; lessons from Ania and links are in the show notes. Visit www.roycoughlan.com, scan the QR code in the video, or go to va.world for virtual assistance.

I have just launched my PodFather Podcast Coach Community https://www.skool.com/podfather/about

Start your own SKOOl Academy https://www.skool.com/signup?ref=c72a37fe832f49c584d7984db9e54b71

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

Teatro de idiomas

Polish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.instagram.com/teatrodeidiomas/

https://www.facebook.com/people/Teatro-de-idiomas/61573960503867/

Learnpolish #learnpolishpodcast #polishpodcast

View Details

Welcome to Learn Polish Podcast. Find all episodes at learnpolishpodcast.com and lessons from Ania in the show notes.

In this episode the hosts chat about coffee—unusual recipes (lemon, butter and coconut), effects on energy, sleep, sport and possible dependence—sharing personal stories and practical advice.

For more about the podcast scan the QR code or visit roycoughlan.com, and if you need virtual assistance see va.world. Share with friends.

For more about the host and other podcasts visit roycoughlan.com, and for virtual assistance and website services check VA.world.

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

Teatro de idiomasPolish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.instagram.com/teatrodeidiomas/

https://www.facebook.com/people/Teatro-de-idiomas/61573960503867/

Learnpolish #learnpolishpodcast #polishpodcast

View Details

Learn Polish Podcast, episode 13 with Roy and teacher Kamila. This episode teaches hair vocabulary (włosy), descriptions (długie, krótkie, proste, kręcone), colors (siwe, blond) and common phrases used at the hairdresser (fryzjer).

Listen for example dialogues, useful verbs like mam, masz, farbować, and vocabulary for asking about prices and services in Polish.

For more about the host and other podcasts visit roycoughlan.com, and for virtual assistance and website services check VA.world

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

Teatro de idiomasPolish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.instagram.com/teatrodeidiomas/

https://www.facebook.com/people/Teatro-de-idiomas/61573960503867/

Learnpolish #learnpolishpodcast #polishpodcast

View Details

Welcome to Learn Polish Podcast, episode number 517. Hosts Ania and Roy discuss dealing with illness — from common colds (katar) and natural home remedies to medical treatments, when to rest, and whether to keep training.

They also talk about the role of sauna, diet, and recovery strategies, and compare how people in Poland manage sickness. Find all episodes at learnpolishpodcast.com, YouTube, and Rumble — subscribe, give a thumbs up, and leave a comment.

For more about the host and other podcasts visit roycoughlan.com, and for virtual assistance and website services check VA.world.

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

Teatro de idiomasPolish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.instagram.com/teatrodeidiomas/

https://www.facebook.com/people/Teatro-de-idiomas/61573960503867/

Learnpolish #learnpolishpodcast #polishpodcast

View Details

Episode 516 of Learn Polish Podcast features host Roy and new teacher Ania discussing two fitness stages: bulking (masa) and cutting (redukcja). They mix Polish and English while sharing personal routines, diet tips (protein, natural foods, grilled fish), and workout ideas (gym, kettlebells, walking, sports) to gain muscle or lose weight.

Find episode resources and Ania’s school in the show notes or at learnpolishpodcast.com. For more about Roy scan the QR code or visit roycoughlan.com. For virtual assistance see va.world

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

Teatro de idiomasPolish for all foreigners

Hi, I’m Ania, founder of Teatro de Idiomas. Learning Polish with us isn’t just effective — it’s fun, inspiring, and super exciting! We teach through Spanish, English, or Russian, so you can learn Polish in a language you already know and feel comfortable with.

https://www.instagram.com/teatrodeidiomas/

https://www.facebook.com/people/Teatro-de-idiomas/61573960503867/

Learnpolish #learnpolishpodcast #polishpodcast

View Details

In this Learn Polish Podcast episode (EP 515), a father-and-son duo mix Polish and English while exploring combat sports gear: boxing gloves, hand wraps, protective headgear, nunchaku, bo staff, punching bags, mouthguards, and even using a mannequin partner.

Enjoy quick vocab practice, light training stories, and simple phrases you can reuse—plus brief mentions of their projects and a friendly call to like, rate, and share.

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Instagram: Coming Soon

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

Learnpolish #learnpolishpodcast #polishpodcast

View Details

In episode 12 of Learn Polish Podcast, host Roy Coughlan and teacher Kamila practice essential Polish for eating out at a restaurant.

They cover how to ask if someone is hungry and how to order starters, first and second courses, drinks, and dessert—using examples like garlic bread, chicken with potatoes, tomato soup with noodles, rice with vegetables, fresh orange juice, apple pie, and chocolate ice cream.

Helpful phrases include proszę, co jeszcze, co do picia, ja chcę, and smacznego, plus quick farewells like do widzenia and do usłyszenia.

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

___________________

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Instagram: Coming Soon

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

Learnpolish #learnpolishpodcast #polishpodcast

View Details

In episode 513 of the Learn Polish Podcast, a father-and-son duo practice practical Polish for supermarket shopping. Learn key words and phrases for bread (chleb, pokroić), milk (mleko), eggs, fruit and veg (jabłka, pomidor), cereal (płatki z mlekiem), cheese (ser), fish (ryba), meat (mięso, kilos and types), and household cleaners.

They also cover trolleys (wózek), reusable bags, and payment methods (karta kredytowa, karta debetowa, gotówka), with handy pronunciation and case tips like “z moim synem Danielem.” Perfect for building everyday shopping confidence in Polish.

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Instagram: Coming Soon

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

Learnpolish #learnpolishpodcast #polishpodcast

View Details

In episode 512 of the Learn Polish Podcast, we explore clothing vocabulary in Polish—from formal wear like garnitur (suit) and koszula (shirt) to casual items such as koszulka (T‑shirt), jeansy, and spódnica (skirt).

We also touch on accessories and footwear, including czapka (hat), szalik (scarf), rękawiczki (gloves), buty (shoes), płaszcz (coat), trainers, and korki (football boots), with quick examples and pronunciation practice.

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

___________________

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Instagram: Coming Soon

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

Learnpolish #learnpolishpodcast #polishpodcast

View Details

Join host Roy Coughlan and teacher Kamila in episode 11 of the Learn Polish Podcast, where they explore essential Polish vocabulary around meal times. In this episode, discover how to discuss breakfast and dinner in Polish, including key words like 'śniadanie,' 'obiad,' and 'kolacja.' Enhance your language skills by learning how to correctly use verbs such as 'jeść' (to eat) and 'pić' (to drink), and practice forming simple sentences to talk about your daily meals. Engage with Polish culture by understanding what typical meals include and how they can vary with the seasons. Whether you're a beginner or looking to refine your language abilities, this episode offers valuable insights into Polish dining customs.

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

___________________

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Instagram: Coming Soon

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

Learnpolish #learnpolishpodcast #polishpodcast

View Details

Welcome to episode 510 of the Learn Polish Podcast, where we're diving into the world of gym vocabulary! Join us as we explore essential words and phrases related to gym activities, from "personal trainer" and "water bottle" to "squats" and "bench press". Whether you're a fitness enthusiast or just getting started, this episode will help you flex your Polish language skills.

Discover the Polish terms for common gym equipment and exercises, including "treadmill", "dumbbells", and "sit-ups". With our easy-to-follow discussions and practical examples, you'll be ready to hit the gym with confidence and communicate effectively in Polish.

Don't forget to check out LearnPolishPodcast.com for more episodes, and join us on social media to stay updated on new releases. Happy learning and stay fit.

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

Learnpolish #learnpolishpodcast #polishpodcast

View Details

Welcome to another engaging episode of the Learn Polish Podcast, where we dive into the world of soccer with my son, Daniel. In this episode, we explore various Polish football terms, discussing everything from the goalkeeper's gloves to favorite football clubs.

Join us as we chat about the roles on the field, what happens when a foul is called, and how to say popular soccer actions in Polish. Whether you're a seasoned soccer fan or a curious learner, there's something for everyone in this delightful conversation.

Don't forget to visit learnpolishpodcast.com, YouTube, or Rumble for more episodes, and be sure to check out our TikTok for bite-sized learning moments. Until next week, happy learning.

All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

Learnpolish #learnpolishpodcast #polishpodcast

View Details

Welcome to Episode 10 of the Learn Polish Podcast with your host Roy and teacher Kamila. In this episode, we dive into the world of Polish cuisine, focusing on how to order food in a restaurant. Starting with soups, Kamila teaches you how to say the names of popular Polish soups like tomato, onion, cucumber, mushroom, and more in Polish.

Learn how to role-play a restaurant scenario, order your favorite soup with pasta or rice, and discover phrases to ask for the soup of the day. Additionally, get familiar with common questions you might encounter while dining, such as how to ask for the bill or how you prefer to pay.

This episode is perfect for anyone looking to enhance their Polish language skills and make their dining experience in Poland enjoyable and stress-free. Smacznego.


All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

___________________

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Instagram: Coming Soon

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

___________________

Get Lessons from Marta

https://preply.com/pl/korepetytor/4979176

https://www.instagram.com/martamituraa/

https://www.tiktok.com/@mmikstura

Learnpolish #learnpolishpodcast #polishpodcast

View Details

Join us in this episode of the Learn Polish Podcast as we dive into the vocabulary surrounding hair in Polish. Marta provides insightful lessons on terms related to different hairstyles, including buns, ponytails, braids, and more. Whether you have long locks or keep it short, this episode will enrich your Polish language skills with everyday hair talk.

Tune in for tips on pronunciation and usage, while enjoying a peek into the cultural angle of these expressions, as we also discuss popular Polish names for fairy tales like Rapunzel.


All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

___________________

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Instagram: Coming Soon

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

___________________

Get Lessons from Marta

https://preply.com/pl/korepetytor/4979176

https://www.instagram.com/martamituraa/

https://www.tiktok.com/@mmikstura

Learnpolish #learnpolishpodcast #polishpodcast

View Details

Welcome to the Learn Polish Podcast. This episode continues with part two of our exploration into basic Polish adjectives, building on the foundation set in part one. Hosts discuss essential adjectives such as 'clean', 'dirty', 'peaceful', and 'grateful', providing practical examples and exercises to enhance understanding and fluency.

Join us in this engaging language journey where you'll also learn conversational tips, get to know popular Polish songs, and discover advanced vocabulary to take your Polish to the next level. Whether you're a beginner or advancing in your Polish learning, this episode offers a valuable resource for expanding your language skills.

Explore additional learning opportunities with lesson links provided in both the audio and video show notes, and find out more about the hosts' other podcasts and services. Tune in and enjoy an enriching learning experience.


All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

___________________

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Instagram: Coming Soon

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

___________________

Get Lessons from Marta

https://preply.com/pl/korepetytor/4979176

https://www.instagram.com/martamituraa/

https://www.tiktok.com/@mmikstura

Learnpolish #learnpolishpodcast #polishpodcast

View Details

Join host Roy Coughlan and teacher Kamila in Episode 9 of the Learn Polish Podcast, as they delve into the practical topic of ordering drinks in a restaurant. This episode offers listeners valuable insights into Polish phrases, perfect for enhancing your dining experiences in Poland.

Discover how to order your favorite beverages, whether it's coffee with milk, black coffee, tea with lemon, or even mineral water. Kamila guides you through essential vocabulary, pronunciation, and useful expressions, making it easy to practice and perfect your Polish language skills.

Get ready to impress with your ability to converse comfortably in a restaurant setting, from choosing your drink to asking for the bill. Enhance your Polish-speaking journey with tips and dialogues that prepare you for real-world interactions in Polish eateries. Tune in for engaging language learning and practical fun.


All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

___________________

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Instagram: Coming Soon

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

___________________

Get Lessons from Marta

https://preply.com/pl/korepetytor/4979176

https://www.instagram.com/martamituraa/

https://www.tiktok.com/@mmikstura

Learnpolish #learnpolishpodcast #polishpodcast

View Details

In this episode of the Learn Polish Podcast, hosts Marta and Roy introduce listeners to the world of Polish adjectives, focusing on emotions. Whether you're a beginner or an advanced learner, this episode will enrich your understanding of essential Polish words like 'szczęśliwy' (happy), 'smutny' (sad), and 'cierpliwy' (patient).

Engage with practical examples and relatable conversations that simplify these adjectives, enhancing your ability to express feelings in Polish. Along the way, explore interesting anecdotes about family, vacations, and the cultural context of these words.

Perfect for anyone starting their Polish language journey or looking to refine their existing skills. Tune in for helpful insights and language tips, and don't forget to check out the show notes for Polish lessons with Marta.


All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

___________________

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Instagram: Coming Soon

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

___________________

Get Lessons from Marta

https://preply.com/pl/korepetytor/4979176

https://www.instagram.com/martamituraa/

https://www.tiktok.com/@mmikstura

Learnpolish #learnpolishpodcast #polishpodcast

View Details

Join host Roy Coughlan and teacher Kamila in Episode 8 of the Learn Polish Podcast as they guide you through essential Polish phrases for visiting the doctor's office. In this engaging episode, you will learn how to describe your symptoms and understand common questions from the doctor, whether you are male or female.

Expand your Polish vocabulary with phrases like "Mam gorączkę" (I have a fever) and discover the differences in addressing male and female doctors. Perfect for anyone planning a visit to Poland or looking to enhance their language skills, this episode offers practical insights into handling medical situations in Polish.

Tune in to continue building your Polish language proficiency, one conversation at a time. Don't forget to explore previous episodes to further enrich your vocabulary. Dziękuję bardzo and do widzenia.


All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

___________________

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Instagram: Coming Soon

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

___________________

Get Lessons from Marta

https://preply.com/pl/korepetytor/4979176

https://www.instagram.com/martamituraa/

https://www.tiktok.com/@mmikstura

Learnpolish #learnpolishpodcast #polishpodcast

View Details

Join host Roy Coughlan and teacher Kamila in episode 7 of the Learn Polish Podcast as they delve into the fascinating topic of weather. This episode focuses on teaching essential Polish phrases related to weather conditions, offering learners a practical toolkit for everyday conversations. Whether it's sunny, raining, or freezing, discover how to accurately describe the weather in Polish.

Listeners are encouraged to practice their pronunciation with Kamila's guidance, ensuring a smooth learning experience. This engaging episode not only enhances your Polish vocabulary but also provides cultural insights into common expressions used in Poland.

For additional resources and lessons, visit learnpolishpodcast.com. Tune in next week for more engaging language learning adventures.


All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

___________________

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Instagram: Coming Soon

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

___________________

Get Lessons from Marta

https://preply.com/pl/korepetytor/4979176

https://www.instagram.com/martamituraa/

https://www.tiktok.com/@mmikstura

Learnpolish #learnpolishpodcast #polishpodcast

View Details

Welcome to episode 6 of the Learn Polish Podcast with your host, Roy Coughlan, and teacher Kamila. This episode focuses on learning Polish compliments to enhance your language skills.

Throughout the episode, Roy and Kamila guide you in mastering compliments for both women and men. You'll learn phrases like "jesteś ładna" for "you are pretty" and "masz ładny uśmiech" for "you have a nice smile." For men, expressions like "jesteś przystojny" meaning "you are handsome" are introduced, expanding your Polish vocabulary.

These practical compliments are perfect for everyday interactions, making your conversations in Polish more engaging and natural. To further enrich your learning experience, visit polonuswitch.com for Polish lessons or explore speakingpodcast.com for enhancing your public speaking skills.

Join us next week for more insights and language tips.


All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

___________________

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Instagram: Coming Soon

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

___________________

Get Lessons from Marta

https://preply.com/pl/korepetytor/4979176

https://www.instagram.com/martamituraa/

https://www.tiktok.com/@mmikstura

Learnpolish #learnpolishpodcast #polishpodcast

View Details

Welcome to Episode 500 of the Learn Polish Podcast as we celebrate an incredible milestone of 3 million downloads and 500 episodes. Join us in expressing gratitude to our dedicated followers and contributors, with special thanks to Marta for her invaluable support.

This episode is a vibrant mix of celebration and language learning, as we dive into interesting Polish idioms and phrases. Discover the colorful expressions such as "elephant stepped on his ear" for tone deafness and explore how these phrases translate into English.

We continue to provide engaging insights into the Polish language, encouraging our listeners to deepen their understanding and appreciation of these unique idioms. Thank you for being part of our journey, and we look forward to bringing you many more episodes.


All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

___________________

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Instagram: Coming Soon

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

___________________

Get Lessons from Marta

https://preply.com/pl/korepetytor/4979176

https://www.instagram.com/martamituraa/

https://www.tiktok.com/@mmikstura

Learnpolish #learnpolishpodcast #polishpodcast

View Details

Join us in Episode 499 of the Learn Polish Podcast as we delve into the contents of Marta's makeup and toiletry bag. Discover essential Polish vocabulary related to everyday beauty products like shampoo, conditioner, and micellar water. Whether you're a language enthusiast or curious about Polish culture, this episode offers engaging insights into grooming and skincare. Listen in for practical language learning and a peek into Polish beauty routines


All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

___________________

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Instagram: Coming Soon

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

___________________

Get Lessons from Marta

https://preply.com/pl/korepetytor/4979176

https://www.instagram.com/martamituraa/

https://www.tiktok.com/@mmikstura

Learnpolish #learnpolishpodcast #polishpodcast

View Details

In this enlightening episode, join Roy and his business partner, Kiren Rubah, as they delve into the world of virtual assistance through their company, VA.World. With extensive experience in web design, marketing, and project management, they highlight the importance of understanding and utilizing virtual services tailored to individual business needs.

Kiran shares her journey from web design to comprehensive marketing strategies, emphasizing the significance of building effective websites, software, and landing pages over the past decade. Through candid discussions, they provide insights into the common pitfalls of outsourcing platforms and how VA.World's in-house team offers a seamless experience in project management and client relationship retention.

The episode also explores various services VA.World provides, including course creation, graphic design, social media management, and even AI-driven customer support. Whether it's setting up secure payment systems or simplifying social media strategies, Lauren and Karen explain how their personalized approach ensures clients receive top-tier service without unnecessary complications.

Tune in for a comprehensive understanding of how virtual assistance can revolutionize your business operations with the right expertise, transparency, and dedication to maintaining client satisfaction.

Should Hire a Virtual Assistant?
This week I had a call with my business partner to discuss this topic. Her name is Kiran Rubab with extensive experience in Course Launch Expert ,Branding Strategist , Digital Marketer, Web Disign and a lot more

podcasting #podmatch #virtualassistants

====================
Join Podmatch ⁠⁠ ⁠https://www.joinpodmatch.com/roy⁠

Speaking Podcast Social Media / Coaching My Other Podcasts ⁠ ⁠https://bio.link/podcaster ⁠⁠
====================
Bio of my Business Partner Kiran Rubab Course Launch Expert | Serial Entrepreneur | Branding Strategist | Digital Marketer | An Empath | A Sister | A Friend | Mentor | Teacher
👋 Hi there! I am Kiran, an online business enthusiast with a decade of experience helping SME’s and solopreneurs with online business growth through my design, marketing, and consulting. 🚀
My core expertise is in course launch, web design and digital marketing 💻📈🚀

What we Discussed:

00:00 Why I am doing this Episode

00:55 Kiran's Work Experience

01:45 Roy's own Experience

03:30 Our Office and how we protect your passwords

07:30 How Some Companies Trick you to Pay more

08:28 We can manage or teach you how to edit yourself

09:50 A Client Testimonial

10:48 We Can do Price per Hr or a Fixed Package

12:25 We can help with Course Creation

14:00 Creating Logos & Social Media Pages and Admin Support

15:15 Using Ai Agents to Automate the Process

18:25 How we suggest ways to increase your reach

18:40 We can Safely Set up Stripe & Paypal Payments for Clients

20:00 Do Not Worry if you are not Technical

20:40 Just Book a Free Discovery Call

21:55 We have Clients in the USA, Canada, UK, Europe and Australia

22:20 We Do Not Use Slimy Sales Tricks

How to Contact Roy & Kiran

https://va.world/

Book a free Call to see if we can help you https://va.world/contact/

___________________
🤝 Join our PodFather Community
✦ Website: ⁠https://www.podfather.me/⁠
✦ YouTube: / @roycoughlan
✦ Instagram: / podfather.podcast
✦ Facebook: / podfather.me
✦ TikTok: / roycoughlanpodcaster
___________________
Find me at

⁠https://roycoughlan.com/⁠

&

⁠https://bio.link/podcaster⁠

Start your Podcast here ⁠https://bestpodcastcoach.org/⁠

Podcasters Submit your Tips here ⁠https://forms.gle/9w1NduFbC5jRX2En9⁠

Sign up fo my Affiliates

⁠https://bestpodcastcoach.org/affiliate-area/⁠

VA Affiliate ⁠https://va.world/affiliate-area/⁠

Brain Gym Affiliate⁠ ⁠https://braingym.fitness/affiliate-area/⁠

Join Podmatch ⁠⁠⁠ ⁠https://www.joinpodmatch.com/roy⁠

podcastguesting #podcasthosting #podcastshow #podcastcoach #VA

View Details

Welcome to the Learn Polish Podcast, Episode 497, where we dive deep into the fascinating world of Polish makeup vocabulary. Whether you're a beginner or advanced learner, this episode has something for everyone. Listen in as we explore essential Polish terms for makeup, including foundation, powder, and mascara, offering both linguistic insights and cultural context. Whether you're looking to impress your Polish friends or simply expand your vocabulary, this episode will guide you through common phrases and expressions used in the beauty industry. Don't miss out on this uniquely engaging language lesson hosted by Marta and Roy. Tune in now and elevate your Polish skills.


All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

___________________

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Instagram: Coming Soon

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

___________________

Get Lessons from Marta

https://preply.com/pl/korepetytor/4979176

https://www.instagram.com/martamituraa/

https://www.tiktok.com/@mmikstura

Learnpolish #learnpolishpodcast #polishpodcast

View Details

Welcome to episode 496 of the Learn Polish Podcast. Join Roy and Marta as they explore the essentials of what's typically found in a makeup and literature bag, both from British and American perspectives. They delve into the Polish vocabulary surrounding personal care items, such as creams, toothbrushes, toothpaste, and more.

This episode not only enhances your understanding of Polish language nuances but also offers cultural insights into how everyday items are categorized and used in different contexts. Perfect for beginners and advanced learners, the episode is guided by Marta's expert teaching to help you expand your Polish vocabulary seamlessly.


All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

___________________

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Instagram: Coming Soon

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

___________________

Get Lessons from Marta

https://preply.com/pl/korepetytor/4979176

https://www.instagram.com/martamituraa/

https://www.tiktok.com/@mmikstura

Learnpolish #learnpolishpodcast #polishpodcast

View Details

Welcome to the fifth episode of the Learn Polish Podcast, where host Roy Coughlan is joined by teacher Kamila for an engaging lesson on discussing hobbies and interests in Polish. This episode focuses on the practical question "Co lubisz robić?" meaning "What do you like to do?" and explores various popular hobbies such as swimming, reading, listening to music, traveling, and more.

Join the conversation and expand your Polish vocabulary as Roy and Kamila dive into pronunciation and sentence construction, ensuring that you get a grip on expressing your likes and dislikes. Whether you enjoy sports, reading books, or simply taking a stroll, this episode arms you with the right phrases to speak confidently about your passions in Polish.

Don't miss out on this opportunity to learn new words and phrases, and stay tuned for next week's episode where we will delve into more exciting topics. For additional lessons, visit polonuswuch.com, and explore our Speaking Podcast available on all platforms.

___________________

🤝 Join our learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Instagram: Coming Soon

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

___________________

View Details

Welcome to the fourth episode of the Learn Polish Podcast, hosted by Roy Coughlan and Polish teacher Kamila. This episode dives into practical questions and answers that will help you communicate effectively in Polish, whether in formal or informal contexts.

You'll learn how to ask and respond to questions about languages, such as "What language do you know?" and "Do you speak Polish?" in Polish. The episode also introduces essential Polish phrases for everyday use, including how to ask for clarification and express understanding.

Join us in expanding your Polish vocabulary and improving your language skills.

___________________

🤝 Join our learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Instagram: Coming Soon

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

___________________

View Details

Welcome to episode three of the Learn Polish Podcast with your host Roy and teacher Kamila. In this episode, Kamila guides Roy through essential Polish phrases, focusing on nationalities and their formal and informal variations. Learn how to introduce yourself by answering the question 'Kim jesteś?' and discover the appropriate phrases for different social settings. This episode also introduces polite expressions to use when meeting people, ensuring you can navigate Polish conversations with ease. Listen in to strengthen your Polish language skills and boost your confidence in speaking.

___________________

🤝 Join our learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Instagram: Coming Soon

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

___________________

View Details

Welcome to Episode 492 of the Learn Polish Podcast. Dive into the world of Polish idioms with co-hosts Marta and Roy as they unravel expressions related to the word 'eye.' Gain insights into practical uses of language while enjoying casual conversations about travel, weather, and more. Learn how to use idiomatic expressions like „wpaść komuś w oko” and „oko w oko”, and enhance your Polish language skills with this engaging episode. Whether you're a language enthusiast or just curious about Polish, this episode offers a delightful and informative experience. Don't miss the chance to expand your Polish vocabulary and cultural understanding. Listen now and join the conversation.


All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

___________________

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Instagram: Coming Soon

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

___________________

Get Lessons from Marta

https://preply.com/pl/korepetytor/4979176

https://www.instagram.com/martamituraa/

https://www.tiktok.com/@mmikstura

Learnpolish #learnpolishpodcast #polishpodcast

View Details

In this episode of the Learn Polish Podcast, Marta and Roy explore the vocabulary related to parts of the face in Polish. Tune in to discover not only how to name different facial features, but also interesting tidbits about Polish language structure and usage. Perfect for language learners eager to expand their vocabulary


All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

___________________

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Instagram: Coming Soon

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

___________________

Get Lessons from Marta

https://preply.com/pl/korepetytor/4979176

https://www.instagram.com/martamituraa/

https://www.tiktok.com/@mmikstura

Learnpolish #learnpolishpodcast #polishpodcast

View Details

Join us in this episode of the Learn Polish Podcast as we delve into the essentials of navigating public transportation in Poland. Learn the key vocabulary and phrases you'll need for getting around Polish bus stops, understanding timetables, and distinguishing between different types of stops. Whether you're planning to visit Poland or just want to expand your language skills, this episode is packed with practical tips to make your journey smoother.

Our host Marta provides insights on how to inquire about bus lines, check schedules, and even the etiquette on smoking at bus stops. Additionally, we discuss the intricacies of traveling to popular locations like Warsaw airport and the convenience of public transport.

Tune in and enhance your Polish language skills while gaining confidence in navigating the country's public transport system. Don't forget to check out our website for more episodes and Polish lessons.


All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

___________________

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Instagram: Coming Soon

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

___________________

Get Lessons from Marta

https://preply.com/pl/korepetytor/4979176

https://www.instagram.com/martamituraa/

https://www.tiktok.com/@mmikstura

Learnpolish #learnpolishpodcast #polishpodcast

View Details

Welcome to episode 489 of the Learn Polish Podcast, where Roy and Marta dive into the intricacies of Polish transportation vocabulary. In this enlightening episode, listeners learn about different means of transport, including cars, buses, coaches, and planes, with particular emphasis on the grammatical cases used.

Marta delves into the details of the Polish language, explaining words like "samochód" and "autobus," while also touching on cultural nuances and common slang terms. The conversation offers practical insights for learning how to navigate travel discussions in Polish, with tips on conjugation and declension.

This episode also highlights the varying transport conditions in Poland, discussing speed limits, road conditions, and common travel preferences. Whether you're planning a trip to Poland or simply want to enhance your Polish linguistic skills, this episode provides valuable information and language tips to boost your confidence in handling transport-related conversations.


All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

___________________

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Instagram: Coming Soon

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

___________________

Get Lessons from Marta

https://preply.com/pl/korepetytor/4979176

https://www.instagram.com/martamituraa/

https://www.tiktok.com/@mmikstura

Learnpolish #learnpolishpodcast #polishpodcast

View Details

Welcome to episode 488 of the Learn Polish Podcast, where we dive into the various rooms found in a typical Polish home. Join Roy and Marta as they explore the essential spaces such as kitchens, dining rooms, and living rooms, as well as the differences between a przedpokój and a korytarz. Discover how Polish culture influences the use of these spaces, and learn common vocabulary to describe different home environments.

This episode also touches on additional areas like balconies, basements, and terraces, offering a comprehensive guide to Polish home terminology. Whether you're just starting to learn Polish or looking to enhance your language skills, this episode is packed with useful insights and practical language tips.


All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

___________________

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Instagram: Coming Soon

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

___________________

Get Lessons from Marta

https://preply.com/pl/korepetytor/4979176

https://www.instagram.com/martamituraa/

https://www.tiktok.com/@mmikstura

Learnpolish #learnpolishpodcast #polishpodcast

View Details

In this episode of the Learn Polish Podcast, join Roy and Marta as they explore the stunning beaches of Poland. Discover the difference between sandy and pebble beaches, and delve into the unique Polish beach culture, including the use of paravany for privacy.

Learn new Polish vocabulary related to the beach, from sandcastles to sunbeds, and find out what makes Polish seaside so special. Whether you're planning a visit or just curious about Polish beaches, this episode offers insights and language tips for beach enthusiasts and language learners alike.


All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

___________________

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Instagram: Coming Soon

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

___________________

Get Lessons from Marta

https://preply.com/pl/korepetytor/4979176

https://www.instagram.com/martamituraa/

https://www.tiktok.com/@mmikstura

Learnpolish #learnpolishpodcast #polishpodcast

View Details

Welcome to the Learn Polish Podcast, where you can enhance your language skills with Marta. In this episode, she is joined by Roy to discuss the recent presidential elections in Poland. They delve into the role of the election commission and share insights on the election process. Despite the challenges of working with the election commission, Marta finds it engaging and shares her experience.

This episode covers essential election-related vocabulary, including terms like 'Komisja Wyborcza' (Election Commission), 'lokal wyborczy' (polling station), and 'frekwencja wyborcza' (voter turnout). The duo also discusses the importance of voter participation and how every vote counts in shaping the country's future.

Listen in to expand your Polish vocabulary and get a glimpse into the political landscape of Poland. For lessons with Marta, check the audio and video show notes, and explore other resources at RoyCoughlan.com. If you need virtual assistants, visit va.world


All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

___________________

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Instagram: Coming Soon

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

___________________

Get Lessons from Marta

https://preply.com/pl/korepetytor/4979176 https://www.instagram.com/martamituraa/ https://www.tiktok.com/@mmikstura

Learnpolish #learnpolishpodcast #polishpodcast

View Details

Welcome to the Learn Polish Podcast, where language meets culture. In this episode, hosts Marta and Roy delve into the Polish vocabulary surrounding elections, providing listeners with valuable insights into political terminology. From understanding the nuances of words like "wybory" and "wybór" to the significance of "cisza wyborcza" or election silence, this episode equips you with the essential language tools for navigating political discussions in Polish.

Join us as we explore the grammatical intricacies and contextual applications of Polish words related to elections, while also offering practical language tips. Perfect for language enthusiasts and learners looking to enhance their Polish vocabulary.


All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

___________________

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Instagram: Coming Soon

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

___________________

Get Lessons from Marta

https://preply.com/pl/korepetytor/4979176 https://www.instagram.com/martamituraa/ https://www.tiktok.com/@mmikstura

Learnpolish #learnpolishpodcast #polishpodcast

View Details

In this episode of the Learn Polish Podcast, hosts Marta and Roy dive into the world of musical instruments, exploring their Polish names and discussing their personal musical experiences. From the piano to the violin, and the saxophone, discover how similar or different these names are compared to English.

Marta shares her love for music, recounting her journey with the piano and other instruments, while Roy talks about his past experience with the guitar. Whether you're a music enthusiast or just curious about learning Polish, this episode offers a delightful blend of language lessons and musical insights.


All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

___________________

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Instagram: Coming Soon

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

___________________

Get Lessons from Marta

https://preply.com/pl/korepetytor/4979176 https://www.instagram.com/martamituraa/ https://www.tiktok.com/@mmikstura

Learnpolish #learnpolishpodcast #polishpodcast

View Details

Join us in this engaging episode as we delve into the world of reading with Marta and Roy. Discover how books play a significant role in enriching our lives, enhancing language skills, and expanding knowledge.

As Marta and Roy discuss their favorite genres and authors, gain insights into the books that have left a lasting impact on them. Whether it's historical, psychological, or classic literature, there's something for every book lover.

Learn useful Polish vocabulary related to books and reading, making this episode both educational and enjoyable for Polish learners and book enthusiasts alike.


All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

___________________

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Instagram: Coming Soon

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

___________________

Get Lessons from Marta

https://preply.com/pl/korepetytor/4979176 https://www.instagram.com/martamituraa/ https://www.tiktok.com/@mmikstura

Learnpolish #learnpolishpodcast #polishpodcast

View Details

Welcome to the Learn Polish Podcast, where we delve into the vibrant world of concerts across Poland. Join us as we explore various venues from massive stadiums to intimate clubs, highlighting the unique experiences each has to offer.

In this episode, you'll discover the excitement of attending a concert from securing your ticket to enjoying unforgettable performances by both Polish and international artists. Whether it's a classical music hall or an outdoor festival, there's a concert for every music lover.

We also share our personal concert experiences, featuring international acts such as The Weeknd and local Polish favorites like Kaśka Sochacka. Listen in to learn useful Polish vocabulary and phrases associated with concerts, and get inspired to attend your next live music event.


All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

___________________

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Instagram: Coming Soon

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

___________________

Get Lessons from Marta

https://preply.com/pl/korepetytor/4979176 https://www.instagram.com/martamituraa/ https://www.tiktok.com/@mmikstura

Learnpolish #learnpolishpodcast #polishpodcast

View Details

Welcome to episode 481 of the Learn Polish Podcast. Join us as we dive into the intricacies of traveling by train in Poland. Discover essential vocabulary related to train travel, including ticket types, carriage classes, and seating arrangements. Learn from personal experiences about the challenges and conveniences of Polish trains, including the common delays and the unique dining and sleeping carriages. Perfect for language learners and travel enthusiasts alike, this episode will equip you with both useful Polish terms and practical travel insights.


All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

___________________

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Instagram: Coming Soon

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

___________________

Get Lessons from Marta

https://preply.com/pl/korepetytor/4979176 https://www.instagram.com/martamituraa/ https://www.tiktok.com/@mmikstura

Learnpolish #learnpolishpodcast #polishpodcast

View Details

Welcome to this episode of the Learn Polish Podcast, where our hosts explore the theme of summer vacations by the lake, in Polish "nad jeziorem." The episode delves into common activities around the lake, teaching essential vocabulary and grammar related to lake and water activities in Polish.

This episode highlights the use of Polish prepositions when talking about being by different bodies of water, such as lakes, rivers, and seas, incorporating instrumental case usage with nouns. Our hosts also provide insights into fun water activities like swimming, canoeing, and jet skiing, along with practical phrases for renting water equipment like boats and water bikes.

Listeners will gain practical language skills and vocabulary to enhance their summer experiences by Polish lakes and enrich their understanding of the Polish language intricacies.


All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

___________________

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Instagram: Coming Soon

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

___________________

Get Lessons from Marta

https://preply.com/pl/korepetytor/4979176 https://www.instagram.com/martamituraa/ https://www.tiktok.com/@mmikstura

Learnpolish #learnpolishpodcast #polishpodcast

View Details

Welcome to episode two ( Re-Mastered) of the Learn Polish Podcast, hosted by Roy Coughlan with Polish teacher Kamila from Polona School in Łódź. In this episode, we'll delve into essential Polish phrases, learning how to ask and answer the questions "Where are you from?" and "Where do you live?"

Join us as Kamila guides Roy through both informal and formal ways to inquire about someone's origin and residence, practicing responses for different contexts. Whether introducing yourself or navigating a conversation in Polish, this episode provides valuable insights into Polish language basics.

___________________

🤝 Join our learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Instagram: Coming Soon

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

___________________

View Details

In this episode of the Learn Polish Podcast, we delve into the fascinating world of Polish idioms featuring the mighty wolf. Join us as we explore various sayings and expressions, such as "as hungry as a wolf" and "a wolf in sheep's clothing," and uncover their meanings and usage in everyday conversation.

Marta and Roy also discuss parallels between Polish and English idioms, offering insights into cultural nuances and language translation challenges. Whether you're learning Polish or simply love languages, this episode is packed with interesting linguistic tidbits.

Tune in to expand your idiomatic knowledge and enhance your understanding of Polish expressions that vividly illustrate the richness of the language.


All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

___________________

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Instagram: Coming Soon

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

___________________

Get Lessons from Marta

https://preply.com/pl/korepetytor/4979176 https://www.instagram.com/martamituraa/ https://www.tiktok.com/@mmikstura #Learnpolish #learnpolishpodcast #polishpodcast

View Details

Welcome to episode 477 of the Learn Polish Podcast. In this episode, we dive into the unique Polish tradition of Śmigus-Dyngus, also known as Wet Monday or Lany Poniedziałek. Celebrated on the Monday after Easter, this fun-filled custom involves people, especially children and young adults, joyfully splashing each other with water. It's a symbolic act of cleansing, renewal, and welcoming the spring season.

Join us as we explore this lively tradition, discuss its origins and variations across different regions, and share personal anecdotes and experiences. Whether you're familiar with Śmigus-Dyngus or new to this festive occasion, discover why this tradition holds a special place in Polish culture.

Don't miss out on this wet and wild episode that brings a splash of Polish tradition to your day.


All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

___________________

🤝 Join our Learn Polish Podcast Community

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Instagram: Coming Soon

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

___________________

Get Lessons from Marta

https://preply.com/pl/korepetytor/4979176 https://www.instagram.com/martamituraa/ https://www.tiktok.com/@mmikstura #Learnpolish #learnpolishpodcast #polishpodcast

View Details

The 1st Epiosde has 60K listeners and comments were about the sound quality. The sound has been improved and its a nice revision exercise.

Welcome to the first episode of the Learn Polish Podcast, hosted by Roy Coughlan with Polish teacherKamilla from Polonus School in Łódź. In this introductory episode, you'll delve into common greetings and introductions in Polish, distinguishing between formal and informal interactions.

Join us as we explore basic conversational phrases such as saying "hello," introducing yourself, and inquiring about someone's well-being. You'll learn to pronounce numbers in Polish – an essential skill for everyday interactions, including sharing your phone number.

This lesson provides a foundational overview of Polish language basics, perfect for beginners eager to engage in simple conversations. Whether you're visiting Poland or keen on understanding the language, this episode offers valuable insights and practical guidance.

___________________

🤝 JOIN OUR LERAN POLISH PODCAST COMMUNITY

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Instagram: Coming Soon

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

___________________

View Details

In this engaging episode of the Learn Polish Podcast, hosts Roy and Marta delve into the vocabulary and cultural nuances of different types of Polish houses. Starting with the basics, they discuss the meaning of 'dom' and 'blok', and move on to explore the various forms of residential buildings, such as 'wieżowiec' and 'drapacz chmur'.

Listeners will gain insights into the linguistic and cultural aspects of housing in Poland, including the differences between blocks of flats, skyscrapers, and more traditional homes like 'bliźniak' and 'dom szeregowy'. The episode also covers important related vocabulary, ensuring that learners not only understand the words but also their practical usage in everyday Polish conversation.

Perfect for Polish language enthusiasts and anyone interested in Polish culture, this episode is sure to enrich your understanding of how homes and living spaces are discussed in Poland.


All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

___________________

🤝 JOIN OUR SPEAKING PODCAST COMMUNITY

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Instagram: Coming Soon

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

___________________

Get Lessons from Marta

https://preply.com/pl/korepetytor/4979176 https://www.instagram.com/martamituraa/ https://www.tiktok.com/@mmikstura #Learnpolish #learnpolishpodcast #polishpodcast

View Details

In this episode of the Learn Polish Podcast, Roy and Marta dive into the versatile Polish word "kawałek." Join them as they explore its various meanings, from a simple slice of cake or pizza to its usage in music and everyday snippets of conversation. With engaging examples and lively discussion, they unravel how this word can transform ordinary interactions into richer experiences.

Whether you're ordering food, talking about music, or managing everyday situations, understanding "kawałek" will enhance your Polish vocabulary. Discover how this word adapts to different contexts, making communication both fun and effective.

This episode is your gateway to expanding your Polish language skills, offering practical tips and vivid examples. Tune in and become more confident in your language journey.


All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

___________________

🤝 JOIN OUR SPEAKING PODCAST COMMUNITY

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Instagram: Coming Soon

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

___________________

Get Lessons from Marta

https://preply.com/pl/korepetytor/4979176 https://www.instagram.com/martamituraa/ https://www.tiktok.com/@mmikstura #Learnpolish #learnpolishpodcast #polishpodcast

View Details

Join Marta and Roy in this engaging episode of Learn Polish Podcast as they explore the versatile Polish word "kawał" and its various meanings. Whether it's a piece, a joke, or a story, this episode will deepen your understanding and usage of the word in different contexts.

Listen as they share examples and discuss common phrases, enhancing your Polish language skills in a fun and interactive way. Perfect for language learners eager to expand their vocabulary and enjoy a good laugh. Tune in now


All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

___________________

🤝 JOIN OUR SPEAKING PODCAST COMMUNITY

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Instagram: Coming Soon

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

___________________

Get Lessons from Marta

https://preply.com/pl/korepetytor/4979176 https://www.instagram.com/martamituraa/ https://www.tiktok.com/@mmikstura #Learnpolish #learnpolishpodcast #polishpodcast

View Details

Welcome to the Learn Polish Podcast, episode 472! Join us as we delve into the nuances of the Polish language, focusing on two intriguing adjectives, "wolny" (free) and "zajęty" (busy). We explore their multiple meanings and how they can be used in everyday contexts, from asking if someone is free for a coffee to declaring a seat occupied. Whether you’re a language enthusiast or a Polish learner, this episode offers valuable insights. Don’t miss out on the engaging discussions and practical examples that will help enrich your Polish vocabulary.


All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

___________________

🤝 JOIN OUR SPEAKING PODCAST COMMUNITY

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Instagram: Coming Soon

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

___________________

Get Lessons from Marta

https://preply.com/pl/korepetytor/4979176 https://www.instagram.com/martamituraa/ https://www.tiktok.com/@mmikstura #Learnpolish #learnpolishpodcast #polishpodcast

View Details

Welcome to the revitalized Learn Polish Podcast, where Roy introduces his new co-host, Marta Mitura. After a hiatus, the podcast is back, bringing vibrant energy and a new perspective on learning Polish. Marta shares her passion for teaching Polish, as well as insights about herself, including her hobbies, education, and more. Join Roy and Marta in this episode as they dive into basic Polish phrases, discuss the challenges and nuances of learning the language, and offer engaging lessons in a fun and interactive way.


All about Roy / Brain Gym & Virtual Assistants at ⁠https://roycoughlan.com/⁠

___________________

🤝 JOIN OUR SPEAKING PODCAST COMMUNITY

✦ Website: https://www.learnpolishpodcast.com/ & https://learnpolish.podbean.com/

✦ YouTube: / https://www.youtube.com/@learnpolish

✦ Instagram: Coming Soon

✦ Facebook: / https://www.facebook.com/learnpolishpodcast/

✦ TikTok: / https://www.tiktok.com/@roycoughlanpodcaster

___________________

Get Lessons from Marta

https://preply.com/pl/korepetytor/4979176 https://www.instagram.com/martamituraa/ https://www.tiktok.com/@mmikstura #Learnpolish #learnpolishpodcast #polishpodcast

View Details

Immerse yourself in the richness of the Polish language as we explore floral vocabulary in this episode of Learn Polish Podcast. Host and the co-host Daniel dive into the exciting realm of flower names in Polish, turning a routine podcast episode into an enjoyable linguistic journey.

In the vibrant lexicon of flowers, you'll learn how to say with Daniel how a phone goes 'bing' in Polish! The session further introduces listeners to the Polish names for various types of prominent flowers, such as roses (Róża), lotus (Lotus soup), tulips (Tulipan), lavender (Lavenda), sunflower (Słonecznik), lilies (Lilie), daisies (Stokrotki), and daffodils (Narcissus).

As you familiarize yourself with these words, the hosts also share intriguing tidbits about the flowers. From consuming sunflower seeds to utilizing lavender to ward off pests, the narrative is sure to spark interest.

Join us in this refreshing episode as we continue to explore and appreciate the beauty of the Polish language. Share with us your favorite flower and any other flower names you'd like to learn in Polish. Find this episode and all things related to our podcast at learnpolishpodcast.com. Don't forget to leave us a thumbs up, rate us five stars, and share with your friends!

Na razie. Dziękuję bardzo i do widzenia!

View Details

Welcome to Learn Polish Podcast episode number 465 where we aim to help you expand your vocabulary - this time with a focus on supermarket related words and phrases. In this episode, we'll cover the Polish names for common grocery items, from lemons and onions, to milk and coffee, and many more. Featuring a lively discussion with Daniel, learn about what these everyday items are called in Polish and how to ask for them.

We have compiled a list of items, Daniel will tell you what they are in Polish and you will be able to pronounce them along with our hosts. Learn how to order your groceries in a polish supermarket with phrases like "Czy możesz podać mi cytryny?" (Can you hand me lemons?) and many more. Identify what different kinds of onions, milk or oils are called or how to distinguish between a shopping trolley and a pram, both known as 'vuzek' in Polish.

Ultimately, this episode aims to help you navigate a Polish supermarket with ease and confidence. So whether you're making dinner or baking a cake, we've got you covered! Listen to this episode on learnpolishpodcast.com, YouTube and Rumble and don't forget to leave us a five-star rating and comment. We look forward to hearing from you and enjoy the episode!

View Details

Welcome to episode 464 of the Learn Polish Podcast. In this episode, we delve deep into interesting conversations on how to foster an enriching relationship with your child. You can check out this episode as well as our previous ones on our website, or you can find us on YouTube and Rumble.

Today, we discuss essential factors in maintaining meaningful relationships with your child, be it a son or a daughter. Our approach primarily revolves around 'getting on your child's level'. We believe effective communication happens when each party can relate to the other's experiences and perspectives, hence the need for parental figures to be on the same level, emotionally and mentally, as their children.

We also explore becoming sportscasters or playing and engaging in shared activities, emphasizing the role that one-on-one quality time plays in strengthening bonds. This could be anything from a trip to the cinema or a visit to a theme park like Mandoria or Energialandia.

The podcast further stresses the importance of eating dinner together, highlighting the value of eye contact and conversations over meals. Spending time in the garden and even cooking together was also recommended. Bedtime bonding, such as reading together or solving math problems, is another great way we discuss to connect with your children. Sharing travel experiences, like a vacation in Estonia, was also discussed as a way to build tighter family bonds.

Thus, the episode is a comprehensive guide to practical and effective ways to foster a healthier and closer relationship with your child. Share your tips and strategies with us in the comments, because the more we learn and do together, the better!

View Details

Welcome to the 463rd episode of the Learn Polish Podcast, where we make learning Polish fun and engaging. This episode is dedicated to the classic card game, Uno, and how it is played in Polish culture. The hosts discuss the game mechanics, the importance of each card, the tactics, and the enjoyment they derive from it. Along the way, you'll pick up some Polish vocabulary related to gaming and more.

The hosts take listeners through the entire game, starting from drawing the seven cards, explaining the function of "Change Colour" and "Pass" cards, to the thrill of shouting "Uno" when you're down to your last card. They then describe a couple of Uno variants, such as "Dos Express" and "Uno Flip," adding more excitement and depth to the game. This episode is not just full of linguistic insights but also packed with laughs and friendly banter, making your Polish learning journey an entertaining experience.

Ending the episode on a high note, the hosts encourage listeners to share their own experiences playing Uno. Whether you're a beginner or a seasoned pro, whether you're learning Polish or just love card games, this episode is sure to fascinate you. Find all our episodes on LearnPolishPodcast.com, and don’t forget to rate us and leave your comments.

View Details

Welcome to episode 462 of the Learn Polish Podcast. Today, we delve into an interesting discussion about the game of darts ('Żutki' in Polish). This episode takes a lively turn as Daniel, clothed in a blue top, integrates with the green screen during our recording.

We discuss the nitty-gritty of the dart game, providing translations for key terms in both English and Polish. From tackling the fundamental elements of darts, like singles, doubles, and triples to the complications of scoring in the game, we cover it all. We even touch on the intricacies of the dartboard, specifically the bullseye and the outer segment of it.

Sharing our experiences and tips, we debate about the best strategies in the game. Electronic versus traditional darts, ideal throwing angles, and more - we unpack every aspect of this exciting sport. As a bonus, we even offer a spontaneous invitation to anyone who'd fancy a game of darts with us in Łódź!

We wrap up this episode by expressing gratitude and inviting suggestions from our listeners for future podcasts. If you're ready to learn some Polish through a fun and engaging game, this is an episode you don't want to miss. Enjoy it on our website, YouTube, or Rumble.

View Details

Welcome to episode 461 of the Learn Polish Podcast, "Polish Basics - Learning to Greet in Polish with Daniel", where we are offering new and improved programming while maintaining our mission to help you learn Polish in a fun and interactive setting. This episode is all about greetings in Polish – a must-know topic for anyone planning a trip to Poland or interested in its language and culture.

This episode is guided by the insightful Daniel. To start off, Daniel goes over the fundamental greeting ‘dzień dobry’, equivalent to 'good day' or 'hello', which you would use regularly when meeting somebody. He explains this is a handy phrase to have at the ready, as it's culturally appropriate to use variations of the greeting depending on the time of day and formality of the situation.

We then transition into 'dobry wieczór,' which translates to 'good night' or 'good evening.' This is another common greeting to use throughout your day, particularly if you find yourself in a shop or out later in the night.

The next part of the lesson is about 'Cześć.' It has a dual meaning of ‘hello’ and ‘goodbye’ but is mostly used informally. The less common yet still essential greetings such as 'witam' (welcome) and 'do vidzénia' (goodbye) are also covered.

We wrap up the show detailing how to use various other casual greetings that are popular among youngsters. Even though greetings like 'seama’ (how’s it going) and ‘hey’ aren’t used traditionally, they are quite trendy and convey coolness. Daniel further shares some of his uses of these greetings amongst his friends.

This podcast episode is available on various platforms including Rumble and YouTube, and can be listened on Bitchute. Join us next time for another educational and enjoyable lesson on Polish vocabulary and conversation. Thank you for listening!

Find the show here https://bio.link/podcaster

View Details

Welcome to the 460th episode of Learn Polish Podcast! Are you new to learning Polish? Begin with our older episodes, go back right to the start so you can understand and learn systematically. All our previous episodes are available on LearnPolishPodcast.com. If you want to learn from Kamilla's team, visit Polonuslodz.com.

We're also available on platforms including BitChute, YouTube, and Rumble. Don't forget to subscribe and turn on notifications to know when fresh content is out. Give us a thumbs up and drop your comments - it means a lot to us! https://bio.link/podcaster

In this episode, we dive into the Polish vocabulary associated with the English word ‘Against’. You will learn how to use 'przeciw’ and ‘wbrew’, the two Polish words that equate to 'against'. Understanding their distinctive nuances will help you compose sentences more confidently in Polish. The conversation in the podcast serves as examples on how to use these Polish terms in real, everyday conversations, such as discussions about purchasing a new car or disagreeing with someone's opinion.

Whether listening in the morning or evening, make the most of this episode regardless of time! Happy learning and do zobaczenia next time.

Words used in this Episode:

Przeciw- Against

Krem przeciw starzeniu się skóry- Anti-aging skin cream

Żel przeciw kleszczom- Anti-tick gel

Syrop przeciwkaszlowy- Antitussive syrup

Tabletka przeciwbólowa- Painkiller

Szczepionka przeciw grypie- Vaccine against flu

Wbrew- Against

Syn robi coś wbrew mamie- The son does something against his mother

Nie rób w życiu nic wbrew sobie- Don't do anything in life against your will

Wbrew sobie zostałam w tej pracy- Against myself, I stayed in this job

Wbrew opiniom golf nie jest drogim sportem- Against opinions, golf is not an expensive sport

Kupiłem nowy samochód wbrew żonie- I bought a new car against my wife

View Details

Welcome to a new episode of Learn Polish Podcast. In episode number 459, Roy and Kamila once again delve into the exciting world of the Polish language, this time focusing on new vocabulary and idioms. Whether you are a beginner just embarking on your Polish language journey or an advanced learner looking to push your skills to the next level, this episode offers a unique and enjoyable learning experience.

Dive into handy idioms such as ‘odnosić sukces’ (to succeed), ‘odnosić zwycięstwo’ (to win), ‘odnosić skutek' (to be successful), and learn how to use them correctly in context. They also discuss the more intense topics of accidents and injuries, with idioms such as ‘odnosić obrażenia’ (to be injured).

Amid all the learning, Roy and Kamila also share some light-hearted banter and personal stories, giving you a delightful glimpse into Polish culture, humor, and lifestyle. Stay tuned till the end for additional language learning resources and tips. If you have any suggestions or comments, don't hesitate to reach out – your input is greatly appreciated!

Visit Kamila's team at polonuslodz.com and find all the episodes on learnpolishpodcast.com. And remember, practice makes perfect, so keep learning, and until next time, dziękuję bardzo. Do widzenia!

Word used in this Episode:

Idiomy- Idioms

Odnosić, odnieść sukces- To succeed

Ten mężczyzna odniósł sukces- This man was successful

Odniosłem sukces w życiu, mam święty spokój- I have succeeded in life, I have peace of mind

Pieniądze szczęścia nie dają (ale tylko małe) - Money doesn't buy happiness (but only a little money)

Odnosić, odnieść zwycięstwo- To be victorious

Odnosić, odnieść skutki- To succeed

Odnosić, odnieść obrażenia- To be injured

View Details

In episode number 457 of the Learn Polish Podcast, we delve into welcoming the wonderful season of spring while having a detailed discussion about the fundamental aspects of Polish grammar. We focus on cases, declination, and variations of the word 'Spring' in Polish – an insightful session for those learning the language.

We consider sentence construction using different cases in Polish, illustrating how forms change in various contexts. We talk about the implications of the word 'Wiosna' (Spring) in different cases, making the process interactive and relatable. We also have a look at common errors students might make when translating directly from English, and cover useful grammar corrections.

Breaking down the grammatical designation of 'Spring' in Polish, we show how words transform in Polish cases. We transition from the nominative case, designing sentences depicting the beauty of spring in Polish grammar, to the instrumental case, the accusative case, and beyond.

In this episode, we present not just an introduction to the season, but a deeper understanding of Polish grammar made easy. Join us in our linguistic journey while embracing the essence of spring!

Feel free to comment on whether you enjoy such grammar-focused topics and if you want more podcasts concentrating on Polish cases. Regardless of your preferences, we extend our warm greetings from Roy and Kamila and look forward to catching up soon!

Words used in this Episode of Learn Polish Podcast:

To jest wiosna- It's spring

Wiosna to moja ulubiona pora roku- Spring is my favorite season

Wiosną świeci słońce- The sun shines in spring

Lubię wiosnę- I like spring

Na wiosnę robi się cieplej- It gets warmer in spring

Myślę o wiośnie- I'm thinking about spring

Rozmawiamy o wiośnie- We're talking about spring

Nie lubię wiosny- I don't like spring

Potrzebuję wiosny - I need spring

View Details

Welcome to the 456th episode of Learn Polish Podcast. Today we discuss the traditions and customs surrounding the Easter holiday in Poland. As we delve into the symbolic representations of Easter from little lambs, colourful eggs to daffodils, we add an interesting angle by throwing light on how these symbols differ from those in Ireland.

In this thought-provoking episode, we also entertain the listeners with fun facts about some common Easter dishes and flowers that signify this holiday. Reminiscing about Easter in Poland and Ireland, we compare the differences and peculiarities of the holiday in both countries. For example, while the Poles follow a custom of painting eggs (pisanki), this tradition is seemingly absent in Ireland.

We also explain the Polish custom of Święconka or the blessing of the Easter basket and compare it with Irish traditions. We talk about how the variety of food and even alcohol is brought to church on Holy Saturday to be blessed and then eaten on Easter Sunday in Poland, a tradition which is not seen in Ireland.

Intriguingly, we also explore the language link between the Easter cake (Babka) and interesting phrases in Polish. We encourage you to join us on this fascinating journey to understand the rich cultural nuances of the Easter holiday in Poland and Ireland. We invite listeners to share their Easter traditions in the comments to help us broaden our understanding of these cultural celebrations.

Whether it's the charming tales of the Easter Bunny or the solemn church rituals, tune in to this podcast episode to feel the spirit of Easter from different cultural perspectives. Comment, share, and join us next week for more fascinating talks about the Polish language and culture!

Words used in this Episode of learn Polish Podcast:

Święta religijne- Religious holidays

Święta rodzinne- Family holidays

Święta państwowe- Public holidays

Wielkanoc- Easter

Zając- Hare

Królik- Rabbit

Pisanki (malowane jajka)- Easter eggs (painted eggs)

Kolor żółty- Yellow color

Żonkil- Daffodil

Żurek- Sour soup

Babka wielkanocna- Easter cake

Święconka- Easter basket

Święcić pokarm- Bless food

Czekoladowe jajka- Chocolate eggs

View Details

Welcome to Learn Polish Podcast, episode 455, where we delve into the intriguing world of children and what they like to do. Joined by my son Daniel, we delve into various activities that engage children. From running, jumping, swinging to climbing trees and more, we uncover a refreshing perspective that children bring to the table.

Fascinated by the nuances of the Polish language? Daniel and I discuss words for various activities and states, like biegacz (to run), spragniony (thirsty), skakacze (jump), and chodzić po drzewach (like climbing a tree). Tune in to enrich your Polish vocabulary as we further delve into a variety of verbs and phrases linked to children's activities.

Additionally, we reflect on preferences that shift as kids age, discussing differences between things like trampolining, tree houses, and other forms of play. We even compare various obligations such as school and homework systems in different locations, providing a more diverse outlook.

We encourage our listeners to participate in the discussions and share their thoughts about each episode. Your feedback is immensely valuable for our program. Until our next episode, Dziękuję bardzo, do widzenia.

View Details

Welcome to the Learn Polish Podcast where we delve into the intricacies of the Polish language. In this episode, we dissect the meaning of the word 'O'. The word 'O' is versatile and dynamic in the Polish language, posing an interesting challenge to learners. Let's unravel its mysteries together.

Primarily, 'O' translates to 'about' in English. We utilize it while talking about who or what we are thinking about, bringing to the forefront expressions like o kim myślisz or o czym myślisz, that translate to who are you thinking about or what are you thinking about respectively.

Contrarily, it could also mean 'at' in English during certain contexts, particularly while inquiring about the time. Consequently, we come up with phrases such as, 'O której godzinie budzisz się?' This translates to, 'At what time do you wake up?'.

Interestingly, 'O' is also used quite frequently when asking for something - 'I ask for your help' would be 'Proszę o pomoc' in Polish.

Join us on this linguistic journey as we continue to explore the depths of this lovely language. Give us your thoughts and share your experiences in the comments, and don't forget to subscribe for more enlightening episodes. Enjoy learning with us on Learn Polish Podcast!

Words used in this Episode:

O kim, o czym myślisz?-Who, what are you thinking about?

Myślę o synu- I'm thinking about my son

Myślę o nowych butach- I'm thinking about new shoes

Marzę o nowym domu- I dream of a new house

Budzę się o piątej- I wake up at five

Zaczynam pracę o ósmej- I start work at eight

Obiad mam o osiemnastej- I have a dinner at eighteen

O której godzinie chodzisz spać?-What time do you go to sleep?

Proszę o informację- I ask for information

Proszę o pomoc- Please help

View Details

Welcome to our 453rd episode of the Learn Polish Podcast, an engaging platform that takes you through the depths of the beautiful Polish language! Catch all our exciting episodes on learnpolishpodcast.com and don't forget to subscribe, rate, and share with your friends.

In this episode, we delve into the definitive details of one of the most popular verbs in any language – 'to go' or in Polish 'iść'. Kick-start your language learning journey by mastering the conjugations and usage of this all-important verb. We break down the term and present it to you in a digestible and vibrant manner ensured to make learning fun and easy!

Immerse yourself in this lively interaction between your hosts Kamila and Roy as they discuss legs, shoes, shopping, cinemas, and a whole lot of everyday activities. On top of this, you get a charming glimpse of how a sunny day unfolds in Poland! So, whether you're just entering the fascinating world of Polish or trying to sharpen your existing skills, this episode provides an excellent opportunity to grasp this essential verb and use it where it matters most – in practical, real-life situations.

Don't miss your chance to master the Polish language one verb at a time! Subscribe, like, and share your way to a new linguistic voyage with us. Let's Learn Polish together!

Words used in this Episode:

Iść- To go (on foot)

Nogi- Legs

Ja idę- I go

Ty idziesz- You go

Ona, Ona, Ono idzie- He, She, It goes

My idziemy- We go

Wy idziecie- You go

Oni, One idą- They go

Dokąd dzisiaj idziesz?- Where are you going today?

Dzisiaj idę na basen z moim synem- Today I'm going to the swimming pool with my son

Wieczorem idę do domu- I'm going home in the evening

W weekend idę do teatru- I'm going to the theater this weekend

Czy idziesz w weekend do sklepu?- Are you going to the store on the weekend?

Wieczorem idę do domu- I'm going home in the evening

Dzisiaj idę na spacer z moim psem- Today I'm going for a walk with my dog

View Details

Welcome to Episode 452 of the Learn Polish Podcast where we get up close and personal with school subjects. Tune in, subscribe, and give us a thumbs up on learnpolishpodcast.com or YouTube and Rumble. Discover more about our host and the six other podcast shows by following the bio.link/podcaster

In this enlightening episode, our host is accompanied by his smart son, Daniel. Daniel assists in exploring various school subjects, bringing to life their Polish translations. The subjects include arts and crafts (plastyka), physical education, history, geography, biology, and mathematics.

Immerse yourself in a conversation that delves into interesting areas such as glaciers in Geography, cells in Biology, and calculations in Mathematics. Gain insights into learning strategies like remembering with pictorial representations which the host used when he was a student. The conversation blends the familiar aspects of learning with the unique perspective of a young learner.

The episode concludes with a glance at English as a foreign language and a teaser for the next episode, which promises the introduction of Physics and Chemistry. Listen in and gear up for another informative session, continuing to learn Polish effortlessly as you learn about school subjects.

View Details

In episode 451 of the Learn Polish Podcast, we delve into the fascinating complexities of Polish language, focusing on a single, powerful word— "Czy." We unpack its different meanings, usages, and contexts, providing a rich resource for both new and advanced students of the language.

Throughout the episode, we discuss three main contexts in which "Czy" is used. First, it emulates the English language's question format— "Do you know?", "Do you like?", and "Do you have?". We provide a variety of examples, asking listeners, for instance, whether they "like reading in Polish?" or "know Poland?".

Next, we discover "Czy" as a replacement for the English word "or", shedding light on options and choices in daily conversations. As a simple example, we pose the question of "tea or coffee?" in Polish as "Kawa czy herbata?". Similarly, the podcast takes learners through phrases like "Ciasto czy lody?" and "Ziemniaki czy frytki?", encouraging them to give their own examples.

Finally, we explore "Czy" in use cases mirroring the English "if", lending a conditional layer to sentences. Phrases such as "Zobaczę, czy mam czas" ("I will see if I have time") serve to demonstrate this context, followed by interactive learning by forming new examples.

This episode guarantees easy comprehension and practical learning of the Polish language. It is designed to add depth to the learning process and cultivate everyday conversational skills. Be sure to give us a thumbs up and share with your friends.

Special thanks go to DanielPackard.com for their support. Learn more about reducing anxiety, stress, and handling addictions on their platform. Tune in next week for more, dziękujemy, and do widzenia.

Words used in the show:

Czy lubisz czytać?- Do you like reading?

Czy znasz Polskę? - Do you know Poland?

Czy lubisz Polskę?- Do you like Poland?

Czy umiesz pływać?- Can you swim?

Kawa czy herbata?- Coffee or tea?

Ciasto czy lody?- Cake or ice cream?

Ziemniaki czy frytki?- Potatoes or fries?

Sok pomarańczowy czy woda?- Orange juice or water?

Zobaczę czy mam czas- I'll see if I have time

Nie wiem czy będę miał czas- I don't know if I'll have time

Zobaczę czy pójdę- I'll see if I go

View Details

Welcome to the popular Learn Polish Podcast. In episode 450, we explore the usage of "I am at" and "I am in" in the Polish language. No matter whether you are new to learning Polish or an experienced student, you'll enjoy the discussion and intensive coaching with our hosts. You can find the whole repository of our episodes on learnpolishpodcast.com, Bitchute, Youtube and Rumble.

In this episode, we first give thanks to danielpackard.com for his excellent work in helping people tackle anxiety, stress, and addictions. We joke that after listening to us, his services might come in handy!

The episode continues with an engaging banter in Polish and English between the hosts Kamilla and Roy before immersing in the main grammar topic. They discuss the different ways in which "I am at" and "I am in" can be translated in Polish. Multiple examples are given, both indoors and outdoor ones. The hosts frequently ask questions to listeners, encouraging them to actively participate and think about variations.

This session also covers "I am at or in" in different context scenarios such as being in the region of something or inside a building or a vehicle. The expert explanation provided by Kamilla and Roy's questions would indeed clarify many of your doubts.

By the end of the session, Roy summarizes the main points of the episode in a little revision. Regular listeners have a treat with special grammar topics for grammar enthusiasts. The hosts invite listeners to jot down their questions or comments, promising to address them in the subsequent episodes. The episode ends with a hope for a beautiful day, lots of sun and motivation to learn the Polish language.

An added bonus of this podcast is that you can browse through the hosts' bios, podcast coaching details, and get lessons from Kamilla's team at polonuslodz.com.

A big shoutout to danielpackard.com once again for helping people with anxiety, stress, and addictions. Subscribe to our channel, give us a thumbs up, and share our lessons with your friends for a much-appreciated support.

Join us again next week for more Polish language learning!.

Words used in the show:

Jestem w pociągu- I'm on the train

Jestem w domu- I'm home

Jestem w sklepie- I'm in the shop

Jestem w szkole- I am at school

Jestem na dworcu- I'm at the station

Jestem na przystanku- I'm at the bus stop

Jestem na ulicy- I am on the street

Jestem na stadionie- I'm at the stadium

Jestem na plaży- I'm on the beach

Jestem na lotnisku- I'm on the airport

Jestem nad morzem- I'm at the seaside

Jestem nad jeziorem- I'm by the lake

Jestem nad rzeką- I'm on the river

Jestem u fryzjera- I'm at the hairdresser's

Jestem u lekarza- I'm at the doctor

Jestem u siebie- I'm at home

https://op3.dev/e/

View Details

In this episode of the Learn Polish Podcast, the father and son duo discuss various future professions, in a delightful and engaging conversation. Presenting a unique way of language learning, they throw light on different professional terms in Polish, making the topic both informative and enjoyable.

Talking about being a footballer, the pair playfully delve into attributes required such as skill, training and passion for the game. The conversation then moves towards more serious professions like firefighters, policemen, and teachers. The Polish terms for these jobs are introduced, layered with simplistic explanations about their roles and responsibilities.

Continuing to explore various professions, the hosts move onto discussing doctors, trainers, information technology specialists, and even the endeavor of being a mechanic, creating a comprehensive language learning experience. The episode ingeniously incorporates Polish phrases and words, helping to understand their English counterparts better, as you subconsciously pick up the beautiful language.

Don’t miss this insightful and entertaining episode, targeted at making your journey of learning Polish a smooth and fun-filled one. Tune in on learnpolishpodcast.com, YouTube, Rumble or BitChute. Subscribe and give us a thumbs up!

View Details

Welcome to the 448th episode of the Learn Polish Podcast. Our discussion today revolves around the term 'usługi' or 'services'. We emphasize the relevance of this term in various facets of everyday life and how to effectively communicate about different services in the Polish language. Tune in and improve your command of Polish while enjoying a stimulating conversation.

From barbershops to cobbler services, tailoring, and more, we demonstrate using Polish language in real-life scenarios. Let's dive into the world of services together. You might be surprised how much interesting vocabulary is associated with things as simple as going to a hairdresser or a cobbler.

Not only is this episode a language lesson, but also a sociocultural exploration in connection to services and their relevance in everyday life in Poland. As a bonus, you can also find tips and guidance on how to tackle small language confusions like multiple meanings for one word depending on the context.

So whether you're planning to travel to Poland, learning the language for fun, or wanting to live there permanently, this episode will equip you with practical linguistic tools that will undoubtedly come in handy. Be sure to subscribe and join us every week for more insights into the Polish language.

Words used in this Episode:

Cztery pory roku- Four Seasons

Kalendarzowa wiosna zaczyna się w marcu- Calendar spring starts in March

Wiosna, lato, jesień, zima- Spring Summer Autumn Winter

Pora deszczowa- Rainy season

Wiosną natura budzi się do życia- In spring nature comes to life

Wyjść na zewnątrz- Go outside

Rodzimy się wraz z naturą- We are born with nature

Jaka jest twoja ulubiona pora roku? - What is your favourite season?

Żegnamy zimę i entuzjastycznie witamy wiosnę- We say goodbye to winter and enthusiastically welcome spring

Bieganie na zewnątrz- Running outside

Grać w koszykówkę z synem- Play basketball with my son

All my Podcasts can be found at https://bio.link/podcaster

View Details

Welcome to the fascinating 447th episode of the Learn Polish Podcast. If you're a newcomer, we encourage you to go back and start the journey with us, building your knowledge as you progress. Visit learnpolishpodcast.com to explore all previous episodes, or find us on Bitchute, YouTube, and Rumble. Don't forget to subscribe to get notifications of new releases.

This episode is thoughtfully designed to make learning Polish a fun and engaging experience. With Kamila and Roy as your hosts, get ready to dive deep into the Polish language and culture. This time, we are focusing on the concept of seasons (pory roku), and specifically, the beautiful spring season in Poland. The episode further delves into intriguing discussions on the natural, cultural, and language aspects related to the changing seasons. You'll also get to learn some intriguing vocabulary, including how to say 'outside' (na zewnątrz), 'rain' (deszcz), 'summer' (lato), and much more.

Moreover, we also have a special segment extending gratitude to Daniel Packard for his commendable efforts to help people dealing with anxiety and addictions. You can visit his page to have a free call and learn how he can assist you. Finally, the hosts also tease upcoming discussions on both the Polish tradition of Easter and the Islamic tradition of Ramadan.

Enjoy an insightful and enriching learning experience with this podcast of ours. We aim not just to teach you a new language but also to connect you with its culture. So, subscribe, stay tuned, and learn as you go with the Learn Polish Podcast. Until next episode, dziękuję bardzo i do widzenia.

Find all my other shows at https://bio.link/podcaster

Words used in this Episode:

Cztery pory roku- Four Seasons

Kalendarzowa wiosna zaczyna się w marcu- Calendar spring starts in March

Wiosna, lato, jesień, zima- Spring Summer Autumn Winter

Pora deszczowa- Rainy season

Wiosną natura budzi się do życia- In spring nature comes to life

Wyjść na zewnątrz- Go outside

Rodzimy się wraz z naturą- We are born with nature

Jaka jest twoja ulubiona pora roku? - What is your favourite season?

Żegnamy zimę i entuzjastycznie witamy wiosnę- We say goodbye to winter and enthusiastically welcome spring

Bieganie na zewnątrz- Running outside

Grać w koszykówkę z synem- Play basketball with my son

View Details

Welcome to Learn Polish Podcast, episode number 446 . This episode features an engaging conversation between Roy and his son daniel about everyone's favorite season, enjoying the nice weather, and their preferred outdoor activities.

From engaging discussions about the weather to pondering whether you need to wear sunglasses when the sun's out, the episode presents a fun, context-focused approach to language learning. You'll also hear talks about playing outside, riding bikes, playing football, and participating in the classic game of hide-and-seek — all in the Polish language.

This episode isn’t just about enjoying the great outdoors. You’ll also pick up snippets of interesting cultural information. From Polish naming conventions for birds like the Robin Redbreast (which might leave you chuckling) to a glimpse into Polish gardening and the challenges of dealing with weeds, you'll get a crash course in cultural nuances.

Lastly, there's a discussion about the importance of taking a break from screen time, a problem that is all too common in today's digital age. While technology has its merits, this episode emphasizes the benefits of physical activity and the positive impact it can have on overall well-being.

This podcast episode is a must-listen for anyone looking to gain a deeper understanding of the Polish language and culture while enjoyably improving their linguistic skills.

Find all our episodes on LearnPolishPodcast.com and stay tuned for the next one. Until then, happy language learning!

View Details

Welcome to Episode 445 of the Learn Polish Podcast, your ultimate guide for learning the Polish language. In this episode, Kamila's team will tackle the usage and meaning of the preposition "for" in Polish. You can't miss out on this insightful lesson designed elaborately by your very own Polish language experts! Find all our episodes on our website, and social media platforms like Bitchute, YouTube and Rumble.

This episode delves deep into the world of the Polish language to decode the varied usage of the word "for". In Polish, "for" translates into three contexts: Dla, Na, and Za. Confusing, isn't it? But fear not as your hosts, Roy and Kamila, will explain each context with suitable examples and anecdotes to ensure you understand and remember the concepts.

Whether it's a present for somebody (prezent dla kogoś), waiting for someone (czekam na ciebie) or thanking someone for their help (dziękuję za pomoc), the hosts cover all these scenarios in an engaging discussion in Polish. They will also walk you through some common language errors and provide tips on how to avoid them.

This episode isn't just about learning Polish. It's also about sharing a platform with individuals who strive to make a difference in the world. An honorable mention to danielpackard.com, an initiative working tirelessly to help individuals overcome anxiety, stress, and addiction problems.

So, sit back and enjoy this interactive crash course that promises a wealth of knowledge, laughter, and a window into the intricacies of the Polish language. Remember, every episode brings you a step closer to mastering the language!

Until next week, do widzenia!

View Details

Unearth the secrets to effective phone conversations in Polish in our Learn Polish Podcast's episode 444. Visit learnpolishpodcast.com or tune in on Bitchute, YouTube, and Rumble. Catch host Roy's exciting chit-chat with Kamila in Polish and English and gain a better understanding of the Polish language.

Listen as we discuss the stress students usually experience when making phone calls in Polish. We'll share various phrases and sentence structures that can help you navigate these conversations with ease. With phrases like "Cześć, kumela", "Dzień dobry", and "Czy mogę zadzwonić za godzinę", you’ll learn how to introduce yourself, wait patiently, and inquire if you can call in an hour or so.

Don't fret if you are dealing with urgent matters, and the line is busy, or you have a dead battery. Learn how to express these situations in Polish and how to ask if someone can call you back. If you are interested in wanting to speak with specific individuals, this episode will guide you on how to ask to speak with particular persons in Polish.

Don’t forget to comment if you enjoy talking in Polish over the phone or if you find it challenging. Try this episode’s challenge: make a call and converse in Polish. Share your experiences in the comment section. Let's learn Polish together in an exciting, stress-free way.

View Details

Welcome to episode 443 of 'Learn Polish Podcast', the perfect place to pick up Polish language skills whilst having fun. In this episode, our hosts explore different ways of travelling. It's a spirited conversation with interesting personal experiences and anecdotes that leads to a delightful, educational experience. Visit learnpolishpodcast.com to find all the episodes.

Joining in the conversation is Daniel, who enlightens us on various modes of transportation. From the simplest form like bicycles and scooters to sports-related means like rollerblades and snowboards, every aspect is covered. His personal experiences and preferences make the lesson engaging and easy to grasp.

In addition to transportation, they also touch upon seasons affecting the choice of travel mode, with highlight on their summer and winter experiences. This episode is sure to teach you not only the Polish terms for different means of transport but also make you more conversational in the Polish language.

Plug into this episode of 'Learn Polish Podcast' available now on Bitchute, YouTube, and Rumble. Don't forget to subscribe for regular updates and join us on a journey to master the Polish language. We look forward to having you in our community!

View Details

Welcome to the 442nd episode of the Learn Polish Podcast, an invaluable resource for getting to grips with the nuances of the Polish language. Get ready as we explore an intriguing grammatical topic - the translation of the word 'from' into Polish. As straightforward as it might seem in English, the word 'from' has three different equivalents in Polish: 'z', 'od', and 'znad'. Each has its own unique contexts and usages, making this topic an engaging one to delve into.

Start off with us on the journey of dissecting these prepositions by understanding when and how to use 'z', which could concern place, city, or country. Further solidify your comprehension with a hands-on quiz! Following that, get enlightened on the usage of 'od' in relation to people, days, hours, and months. Lastly, encounter the less conventional 'znad', used in the context of water bodies.

While this episode is teeming with new information, our host maintains a light-hearted atmosphere with friendly banter throughout. Remember to check out www.danielpackard.com, a life-changing resource for people dealing with anxiety, stress, or addiction. The journey through the Polish language is an exciting one, and we thank you for being on it with us.

Whether you're a seasoned learner or a beginner in Polish, let us help you in your quest to master this intriguing language. Keep an eye out for more comprehensive and enjoyable lessons on our website, YouTube, and various podcast platforms.

Find all my social media / podcasts / investments / coaching at https://bio.link/podcaster

Words used in this episode:

Z kina- From the cinema

Z pracy- From work

Skąd wracasz?- Where are you coming back from?

Wracam z Krakowa- I'm coming back from Krakow

Jestem z Łodzi- I'm from Łódź

Jestem z Polski- I'm from Poland

Skąd jesteś?- Where are you from?

Od mojej mamy- From my mother

Od Kamili- From Kamila

Od poniedziałku, soboty- From Monday, Saturday

Pracuję od ósmej- I work from eight

Od maja, lipca- From May, July

Wracam znad morza, znad jeziora, znad rzeki- I'm coming back from the sea, from the lake, from the river

View Details

In this episode 441 of Learn Polish Podcast, embark on a journey to add more words to your Polish Vocabulary focused on a daily life theme - Packagings and Containers. You can find all our episodes on LearnPolishPodcast.com. Our lessons are designed to build one from another so, if you're new, we recommend you to start from the beginning.

Partnered with Kamilas teampolonudlodz.com, you can also find more enriching lessons to plunge deeper into the Polish language.

Find all my other Podcasts & Coaching at https://bio.link/podcaster

In collaboration with danielpackard.com, the episode also covers approaches to manage anxiety, stress, and addiction. You can book a free 15-minute call with Daniel Packard, highlighting his programs with a 90% success rate. https://www.danielpackard.com/

Alongside enriching your polish vocabulary with new words, we also actively engage with audience, encouraging for interaction. In this episode, you'll learn in detail about different types of packagings like cans, bottles, jars, boxes and more, how each of these words is used in daily Polish language, what their translations are in English, and also get to practice their pronunciation. Tune In to the podcast to learn more.

The episode ends with a fun activity, asking you, our listener, to let us know about any other type of packaging names you know of. Looking forward to a fun and interactive learning experience!

Words Used in the show:

Opakowania- Packaging

Sprzedawczyni, sprzedawca- Saleswoman, saleswoman

Karton soku pomidorowego- Carton of tomato juice

Puszka piwa- A can of beer

Przetwory na zimę- Winter preserves

Słoik dżemu- Jar of jam

Tabliczka czekolady- Bar of chocolate

Kostka masła- Cube of butter

Kostka cukru- Cube of sugar

Paczka- Package, box

Pudełko herbaty, kawy- A box of tea, coffee

Zgrzewka wody (sześć butelek wody)- A pack of water (six bottles of water)

View Details

Welcome to the 440th episode of the Learn Polish Podcast. In this episode, a thoughtful conversation unfolds between the host and his son, Daniel. They delve into different themes around 'what children like to do after school', sharing insights into common recreational activities, sports, screen time, and playtime routines.

Daniel opens up about his everyday activities such as sleeping, playing with his pet dog, watching cartoons, and listening to his favorite music. There's an interesting discussion about Daniel's digital hobbies too, notably exploring games like Fortnite on his computer. Daniel's other activities include swimming, specifically their weekly trips to fala in Łódź, and playing on the playground, although he reveals that he now prefers walks with his dog more.

Towards the end of the episode, Daniel shares his sweet routine of playing with friends after school, often indulging in phone games while conversing with them. Tune in to this episode to explore a child's perspective on their after-school time and learn valuable Polish expressions and terms in the process. For more episodes, visit our website learnpolishpodcast.com, or find us on YouTube and Rumble. Don't forget to rate, share, and pass on to friends. Until next week, take care!

View Details

Welcome to the 439th episode of the Learn Polish Podcast, 'Starasz to Czajeszczi Dziwinych.' This platform provides a fun and easy approach to learning and understanding the Polish language. You can find all of our episodes on LearnPolishPodcast.com, Bitchute YouTube, and Rumble.

If you're new, we recommend starting right from the beginning. Lessons are presented by kamilla's expert team from Polonuslodz.com. As part of our network, you can also explore a range of other subjects across six podcasts on meditation, crypto, awakening, exposing fraud and corruption(with practical solutions), and speaking, all in one place. These resources are freely accessible at bio.link/podcaster.

This episode is particularly focused on the understanding of Polish slang, especially significant for social conversations and interaction with teenagers. We discuss the informal words and phrases commonly used in place of the official language. Variations of expressing 'I don't understand,' such as 'nie czaję', 'nie kumam', and 'nie ogarniam' are covered in detail.

We also extend our gratitude towards danielpackard.com for his significant role in helping individuals cope with anxiety, stress, and addictions. He offers a free 45-minute training program to aid in stress reduction.

Join us in this journey and enhance your understanding of informal Polish language. For more lessons and content, tune in next week. Do widzenia!

View Details

Welcome to the 438th episode of "Learn Polish Podcast", an engaging and enlightening platform for those passionate about the Polish language. As the title suggest "Sterysta Trudziszczy Ośm", we discuss everything about love, celebrating it not just with our partners, but also embracing self-love.

The duo, Kamila and Roy engage in conversation about various elements of love including celebrating Valentine's Day, expressing love in Polish, the significance of self-love and much more. They walk you through the basic phrases, such as "Kocham cię" which means "I love you" and "Kocham siebie", translating to "I love myself".

Taken a step further, they also discuss the heartwarming pet names used in Polish like "moje kochanie" (my sweetheart), "mój skarb" (my treasure) and "misiu" (teddy bear) illustrating the beauty and warmth of the Polish language.

Explore more about Polish vocabulary, phrases, and love expressions while enjoying the rapport between Kamila and Roy, ensuring an enjoyable learning experience.

For additional learning material, visit the newly updated website Polonuswitch.com for lessons offered by Kamila's team. Visit bio.link/podcaster for information about our six podcasts. We also express our immense gratitude to our sponsor Daniel Packard for aiding people in combating anxiety, stress, and addictions.

Come join us, express love in Polish, and celebrate it in every shape and form!

View Details

Welcome to the 437th episode of the Learn Polish Podcast where father and son engage in a delightful bilingual conversation. This episode presents a fun discussion centered around the world of toys, ideal for anyone looking to learn Polish in a relaxed and engaging setting.

Join us as Daniel is introduced and the topic of the day, "Zabawki i czym lubisz się bawić", is revealed! That is, "what toys and what you like to play with." This episode serves an ideal platform for learning common Polish words related to toys and play - from "lalka" (doll), "klocki" (blocks or Lego), "miś" (teddy bear), "piłka nożna" (soccer ball), to "samochodzik" (toy car), and "puzzle" (jigsaw).

We explore the stories that lie behind each toy, revealing personal insights paralleled with opportunities to learn more Polish. Daniel's favorite toy sparks an interesting discussion in Polish about football and friends. And in addition to the lively talks about toys, board games like Battleship, Nogi, and Kolejka also find mentions.

By the end of the episode, you'll observe an extensive conversation in Polish and English about toys, board games, and shared family experiences. Dive into Daniel’s amusing play world and learn Polish in an entertaining and informal context.

The lessons end with an invitation to partake in more Polish learning with Kamila's team on polonuslodz.com, and to access all our episodes on learnpolishpodcast.com, YouTube and Rumble, and an opportunity to discover more about our podcast host via bio.link/podcaster

View Details

Welcome to the 436th episode of Learn Polish Podcast! Dive into immersive Polish language learning as we take a tour of a typical Polish living room, known as a 'salon'. Join hosts Kamila and Roy as they guide you through a conversational debate on the functioanl elements of a living room and the terms you need to describe them in Polish.

In this episode, they discuss the meaning and pronunciation of everyday items like a comfortable sofa 'kanapa', a relaxing armchair 'fotel', the radiant lamp 'lampa', and a handy shelf 'regał'. Snatch up the opportunity to practice and improve your Polish language skills as Kamila and Roy touch on other learning points including verbs, phrases and comprehension tasks.

Daniel Packard, our sponsor for this episode, is dedicated to helping individuals deal with anxiety, offering risk-free services with a 90% success rate. If you're seeking relief from anxiety, consider visiting danielpackard.com and explore his free online training resources.

In addition, Kamila and Roy share their personal experiences and reflections on living room trends, offering a glimpse into real-life applications of the Polish language. Dive into the culture as they speak on the role of family mealtimes, televised entertainment, and the use of technology within modern Polish households.

Whether you are a beginner or an advanced learner, this episode will surely enhance your understanding of the Polish language. So sit back, tune in, and enjoy this practical, engaging, and fun learning expedition into the Polish language.

Remember to like, rate, subscribe, and share this podcast with your friends. Check us out on our YouTube, Bitchute, Rumble channel and at learnpolishpodcast.com. We are committed to constantly growing our audience, so feel free to suggest any Facebook groups we should join, or simply leave your feedback and comments for us. Happy learning!

View Details

Welcome to our 435th episode of the Learn Polish Podcast. In this episode, we tackle two frequently misinterpreted verbs, "wydawać" and "spędzać", which both translate to "spend" in English - though, each used in different contexts.

We discuss how "wydawać" is used when talking about spending money, while "spędzać" is applied when referring to spending time. Going through practical examples, we clarify how these two verbs are incorporated into everyday conversations and other language nuances.

Alongside the language lessons, we also take the chance to thank our sponsor, Daniel Packard, who helps individuals manage anxiety, stress, and addiction. He provides a 45-minute free training that you can access on his website, which guarantees immediate results. https://www.danielpackard.com/

Further into the episode, we go into more personal experiences, sharing our latest big purchases, our preferred means of spending time, and our holiday plans, ensuring you grasp every bit of the lesson.

Remember that you can always check out our website, LearnPolishPodcast.com, for all our episodes. Also, if you are interested in starting a podcast or promoting a book or business, be sure to contact us.

Join our vibrant community at Learn Polish Podcast as we continue to make Polish language learning fun and engaging.

Find all about me / video channels / other podcasts https://bio.link/podcaster

View Details

Welcome to the 434th episode of the Learn Polish Podcast! Tune in as we delve deep into the subject of hobbies and favorite pastimes. Available on various platforms including Bitchute, YouTube, and Rumble, you can listen, give us a thumbs up, share with your friends, and rate us five stars!

Join us in this engaging conversation with Daniel on what he loves to do in his free time. From playing video games such as Fortnite or Gran Turismo 7 on PlayStation 5, watching cartoons in the cinema, playing football, putting together puzzles to enjoying board games. Daniel shares his favorites with us.

Not stopping at indoor hobbies, we also discuss outdoor activities. Hear about Daniel's experience playing football, cycling, and even sharing about his favorite travels to Estonia, Lithuania, and Latvia.

Lastly, Daniel shares about his social interactions, discussing time spent with friends at school and at home, playing various games, and bonding over shared interests.

Find all our episodes at LearnPolishPodcast.com. Don't forget to check out bio.link/podcaster for more information about the podcast and for the opportunity to sponsor an episode or participate in any of our shows. Join us next week for another enriching episode. Dziękuję bardzo i do widzenia!

View Details

Welcome to episode 433 of the Learn Polish Podcast, your one-stop destination to polish your Polish language skills. Immerse yourself in the enthralling journey of learning a new language with Camilla, your trusted guide through the complex maze of Polish grammar, vocabulary, and pronunciation. This episode delves deep into understanding and practicing Polish nouns, one of the fundamental building blocks of learning any language.

www.danielpackard.com, our gracious sponsor, ensures the smooth sail of your learning adventure. With a 90% success rate, Daniel helps you conquer anxiety, stress, and addiction. Don't forget to check his free 45-minute video that can be a turning point in your life.

During this grammar-rich episode, Kamila explains the different categories of Polish nouns - people, places, animals, things, and events. Using everyday examples, she creates a tangible environment, making learning more relatable and enjoyable. Engage in an interactive session with quizzes that challenge your understanding of noun classifications and their correct usage in everyday Polish.

Delving into the importance of learning the Polish language couldn't have been easier. Find all the episodes on www.learnpolishpodcast.com, YouTube, and Rumble, and be sure to subscribe for a more enriching experience. Master the art of Polish conversations and impress your peers with your newfound linguistic skills!

Join us for another exciting episode next week, until then, stay enthusiastic and keep learning. Dziękujemy, miłej nauki, do zobaczenia!

In this Episode we discuss:

Rzeczownik- Noun

Nazwy osób- People's names

Nazwy miejsc - Place names

Nazwy zwierząt- Animal names

Nazwy wydarzeń- Event names

Osoba: chłopiec, siostra, mama, lekarz, nauczyciel, Pan Piotr- Person: boy, sister, mother, doctor, teacher, Mr. Piotr

Mama robi obiad- Mom's making dinner

Miejsce: szkoła, sklep, szpital, Azja, Europa, park- Place: school, shop, hospital, Asia, Europe, park

Zwierzęta: pies, ptak, kot, tygrys, małpa, ryba- Animals: dog, bird, cat, tiger, monkey, fish

Rzeczy: książka, piłka, krzesło, buty, kwiaty, szklanka - Things: book, ball, chair, shoes, flowers, glass

Wydarzenia: Boże Narodzenie, Nowy rok, urodziny, ślub - Events: Christmas, New Year, Birthday, Wedding

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

View Details

Welcome to the 432nd episode of the Learn Polish Podcast. Packed with rich content, this episode initiates a thought-provoking conversation about lifestyles and exploring the lifestyle that best suits you. You'll hear an engaging discussion on various life-styles - from an active life brimming with sports and outdoor activities to a sedate one characterized by calmness and organization.

This podcast also discusses the transitions in lifestyle relating to different stages of life and personal preference. In addition, it highlights the importance and implications of adventure — stepping out of the comfort zone, tackling new tasks, and experiencing the adrenaline rush that ensues.

Interspersed with the primary subject are small yet vital lessons in Polish language, allowing listeners to learn new phrases and improve their language proficiency. The episode further emphasizes sponsors such as danielpackard.com. Known for their effective solutions to anxiety and stress, they offer a free 45-minute video that has a 90% success rate.

Listeners are also encouraged to share their preferred lifestyle and discuss what matches their personality and stage of life. This episode is an informative, interesting dive into the subject of lifestyle, offering a fresh perspective on personal choices and preferences. It not only aids you in learning Polish but also instigates intriguing introspection.

Browse through learnpolishpodcast.com or find us on bitchute, YouTube, and Rumble to explore more such interesting episodes. Feel free to subscribe, like, and share. Your support and feedback are hugely appreciated.

If you or know some body you know is struggling with anxiety and want to know how to be 100% anxiety free, in 6 weeks, without therapy or drugs, fully guaranteed - then let me tell you about our sponsor Daniel Packard.

Watch this Free 45 min. Training

to learn an innovative technique that:

a) Quickly lowers your anxiety by up to 85%

b) Proves solving your anxiety can be simple.

https://www.danielpackard.com/

In this Episode we discuss:

Styl życia- Lifestyle

Jaki styl życia Ci najbardziej odpowiada?- What lifestyle suits you best?

Aktywny styl życia- Active lifestyle

Siedzący tryb życia- Sedentary lifestyle

Praca siedząca- Sitting work

Dużo sportu- Lots of sport

Siłownia- Gym

Życie pełne przygód- A life full of adventures

Wpaść w rutynę- Get into a routine

Byłem w czterdziestu krajach- I've been to forty countries

Spokojne i zorganizowane życie- Calm and organized life

Rozwój- Development

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

View Details

In this episode of Learn Polish Podcast, we discuss our dream homes in different places around the world. Join us as we delve into the details of what makes each place special for us and how our preferences change as we grow older. We also talk about how the weather and culture in different locations influence our choices of ideal homes.

The episode begins with an introduction to our sponsor, danielpackard.com, who offers a free 45-minute training session for dealing with anxiety. Our discussion kicks off with our hosts discussing the changes in the weather and how these changes influence our moods.

Our conversation then shifts to the topic of our theme - dream homes. We share our personal experiences of living in different types of homes - from apartments in the city to houses in the countryside and our dream homes. We highlight the aspects of what makes these places unique and how certain factors can affect our preferred choice of housing as we age.

Throughout the episode, we also share some Polish phrases and idioms related to home and living preferences. As always, listeners are encouraged to practice the newly learned language by leaving comments about their dream homes in Polish.

The session ends with a humorous note, thanks given to our sponsor and an invitation to listeners to subscribe to our podcast for current updates. Listen in and join us as we explore different dream homes around the world!

Words used in the show:

Wymarzony dom-Dream house

Kawalerka- Studio apartment

Apartament w mieście- Apartment in the city

Daleko od miasta, od ludzi- Far from the city, from the people

Dom na wsi- House in the countryside

Dom poza centrum miasta- House outside the city center

Dwadzieścia minut samochodem od centrum miasta- Twenty minutes by car from the city center

Większy spokój- More peace of mind

Dom w Hiszpanii- House in Spain

Blisko wody- Close to the water

Mieszkać w górach daleko od ludzi- Living in the mountains far from people

Słońce wschodzi- The sun is rising

View Details

Welcome to the 430th episode of Learn Polish Podcast, titled "Master the Polish Language - Learning Skills & Strategies". Explore a variety of topics revolving around learning Polish, such as pronunciation, grammar, spelling, and more, in an engaging, easy-to-understand format. Understand the importance of regular practice and discover why learning a new language is key to success.

Hear a frank discussion about learning strategies - communication's importance seems to triumph over perfect grammar. Dive into the controversy of learning language through apps versus real-world practice. Uncover the unique challenges of writing in Polish and why grammatical correctness might not be the top priority.

Get insights and tips from learners themselves, their motivations and what they prioritize in their journey of mastering a new language. The episode emphasizes the importance of 'real person' conversation and the connect between communication and grammar.

Don't miss this opportunity to enhance your Polish language learning skills and strategies. Be sure to check our sponsor, danielpackard.com, which offers help with stress, anxiety, and addictions. As always, don't forget to subscribe to our channels and leave your feedback!

View Details

Welcome to episode 429 of Learn Polish Podcast! Find all our episodes on our official website, learnpolishpodcast.com. Learn more about me, my six podcasts and my coaching via the 'Podcaster' link https://bio.link/podcaster. In this episode, I have a special guest, my son, Daniel.

Our topic of discussion for today is pocket money. We talk about various activities that can justify pocket money, like helping parents, cleaning one's room, taking out the rubbish and hanging clothes in the closet. We also bring up the topic of schoolwork and the importance of a balance between studies and free time, as seen in the Finnish school system!

Listen in as we exchange views and have a light-hearted discussion about these everyday topics. Graphic aids related to this episode are available on Bitchute, YouTube, Rumble, and our Facebook page.

Leave us a thumbs up or a five-star rating if you appreciated this episode with my son, Daniel. Listen in next week for more! Thank you!

Words used

Pomagam moim rodzicom.
Sprzątam swój pokójwyjdź z moim zadaniem.
Wynoszę śmieci.
Wkładam ubrania do szafy.
Odrabiam lekcje.
Jestem grzeczny.
Mam dobre oceny w szkole.

View Details

Learn Polish Podcast in a fun way with short Episodes. On this episode we talk about

Wymarzone miejsce pracy- Dream job.

=====

Thanks to my Sponsors for Helping Support me:

If you or know some body you know is struggling with anxiety and want to know how to be 100% anxiety free, in 6 weeks, without therapy or drugs, fully guaranteed - then let me tell you about our sponsor Daniel Packard.

Watch this Free 45 min. Training

to learn an innovative technique that:

a) Quickly lowers your anxiety by up to 85%

b) Proves solving your anxiety can be simple.

https://www.danielpackard.com/


Do you have High Blood Pressure and/ or want to get off the Meds

Doctors are amazed at what the Zona Plus can do

$50 Discount with my Code ROY https://www.zona.com/discount/ROY


Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


1st Episodes https://learnpolish.podbean.com/page/50

======================

In this Episode we discuss:

Praca- Work

Wymarzone miejsce pracy- Dream job

Pracowałem w korporacji - I worked in a corporation

Praca w domu- Work at home

Mieć własny biznes- Have your own business

W biurze- In the office

Praca w szkole- Work in school

Być youtuberem- Being a YouTuber

Praca zdalna (online)- Remote work (online)

Praca w szpitalu- Work in hospital

W korporacji jest bardzo dużo pracy- There's a lot of work in a corporation

Plusy i minusy pracy zdalnej- Pros and cons of remote work

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish Podcast in a fun way with short Episodes. On this episode we talk about

Stanąć na rzęsach - Stand on eyelashes.

=====

Thanks to my Sponsors for Helping Support me:

If you or know some body you know is struggling with anxiety and want to know how to be 100% anxiety free, in 6 weeks, without therapy or drugs, fully guaranteed - then let me tell you about our sponsor Daniel Packard.

Watch this Free 45 min. Training

to learn an innovative technique that:

a) Quickly lowers your anxiety by up to 85%

b) Proves solving your anxiety can be simple.

https://www.danielpackard.com/


Do you have High Blood Pressure and/ or want to get off the Meds

Doctors are amazed at what the Zona Plus can do

$50 Discount with my Code ROY https://www.zona.com/discount/ROY


Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


1st Episodes https://learnpolish.podbean.com/page/50

======================

In this Episode we discuss:

Idiomy- Idioms

Stanąć na rzęsach - Stand on eyelashes

Stanąć- Stand

Rzęsy- Eyelashes

Kobiety malują rzęsy- Women paint their eyelashes

Dużo próbować- Try a lot

Bardzo starać się- Try very hard

Dać z siebie dużo- Give a lot of yourself

Robimy wszystko żeby osiągnąć sukces- We do everything to achieve success

Robimy wszystko co możliwe- We do everything possible

Stawałem na rzęsach żeby zdać egzamin- I stood on my eyelashes to pass the exam

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish Podcast in a fun way with short Episodes. On this episode we talk about

Liczebnik (Jeden) - Ways to say one.

=====

Thanks to my Sponsors for Helping Support me:

If you or know some body you know is struggling with anxiety and want to know how to be 100% anxiety free, in 6 weeks, without therapy or drugs, fully guaranteed - then let me tell you about our sponsor Daniel Packard.

Watch this Free 45 min. Training

to learn an innovative technique that:

a) Quickly lowers your anxiety by up to 85%

b) Proves solving your anxiety can be simple.

https://www.danielpackard.com/


Do you have High Blood Pressure and/ or want to get off the Meds

Doctors are amazed at what the Zona Plus can do

$50 Discount with my Code ROY https://www.zona.com/discount/ROY


Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


1st Episodes https://learnpolish.podbean.com/page/50

======================

In this Episode we discuss:

Liczebnik- Numeral

Jeden- One

Jeden samochód, student, dom, kurczak - One car, student, house, chicken

Jeden dentysta, kierowca, kolega, tata- One dentist, driver, friend, dad

Jedna mapa, kobieta, kawa, herbata, kawa- One map, woman, coffee, tea, coffee

Jedna mysz, pani- One mouse, lady

Jedno słońce, dziecko, piwo, muzeum- One sun, child, beer, museum

Jedno krzesło, wino - One chair, wine

Jedna lampa- One lamp

Jeden zeszyt- One notebook

Jedno masło- One butter

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish Podcast in a fun way with short Episodes. On this episode we talk about

Emocje - Emotions Part 2.

=====

Thanks to my Sponsors for Helping Support me:

If you or know some body you know is struggling with anxiety and want to know how to be 100% anxiety free, in 6 weeks, without therapy or drugs, fully guaranteed - then let me tell you about our sponsor Daniel Packard.

Watch this Free 45 min. Training

to learn an innovative technique that:

a) Quickly lowers your anxiety by up to 85%

b) Proves solving your anxiety can be simple.

https://www.danielpackard.com/


Do you have High Blood Pressure and/ or want to get off the Meds

Doctors are amazed at what the Zona Plus can do

$50 Discount with my Code ROY https://www.zona.com/discount/ROY


Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


1st Episodes https://learnpolish.podbean.com/page/50

======================

In this Episode we discuss:

Emocje - Emotions

Jestem smutna, smutny- I'm sad

Jestem smutny kiedy ktoś nie żyje- I'm sad when someone dies

Jestem nieśmiały, nieśmiała- I'm shy

Nieśmiała osoba nie wierzy w siebie- A shy person doesn't believe in himself

Jest mi przykro- I'm sorry

Jaram się- I'm excited

Jaram się kiedy robię nowe podcasty- I get excited when I make new podcasts

Jestem dumny, dumna- I'm proud

Jestem dumna, że schudłam dwa kilo- I'm proud that I lost two kilos

Jestem dumny bo mój syn ma dobre oceny- I'm proud because my son has good grades

Boję egzaminu, dentysty- I'm afraid of the exam, the dentist

Jestem zmęczony, zmęczona- I'm tired

Jestem zmęczony kiedy rozmawiam z urzędem- I'm tired when I talk to the city office

Jestem chory, chora- I'm sick

Jestem zdrowy, zdrowa- I'm healthy

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish Podcast in a fun way with short Episodes. On this episode we talk about

Emocje - Emotions.

=====

Thanks to my Sponsors for Helping Support me:

If you or know some body you know is struggling with anxiety and want to know how to be 100% anxiety free, in 6 weeks, without therapy or drugs, fully guaranteed - then let me tell you about our sponsor Daniel Packard.

Watch this Free 45 min. Training

to learn an innovative technique that:

a) Quickly lowers your anxiety by up to 85%

b) Proves solving your anxiety can be simple.

https://www.danielpackard.com/


Do you have High Blood Pressure and/ or want to get off the Meds

Doctors are amazed at what the Zona Plus can do

$50 Discount with my Code ROY https://www.zona.com/discount/ROY


Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


1st Episodes https://learnpolish.podbean.com/page/50

======================

In this Episode we discuss:

Emocje - Emotions

Martwię się- I'm worried

Jestem zadowolona, zadowolony- I'm satisfied

Jestem zadowolony kiedy jestem z moją rodziną- I'm satisfied when I'm with my family

Jestem rozczarowana, rozczarowany- I'm disappointed

Jestem zdenerwowana, zdenerwowany- I'm nervous

Jestem szczęśliwa, szczęśliwy- I'm happy

Jestem szczęśliwy kiedy moje podcasty są lubiane- I'm happy when my podcasts are liked

Jestem śpiąca, śpiący- I'm sleepy

Czuję ból- I feel pain

Jestem spokojna, spokojny- I'm calm

Jestem spokojny kiedy słucham medytacji- I am calm when I listen to meditation

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish Podcast in a fun way with short Episodes. On this episode we talk about Przyprawy – Spices.

=====

Thanks to my Sponsors for Helping Support me:

If you or know some body you know is struggling with anxiety and want to know how to be 100% anxiety free, in 6 weeks, without therapy or drugs, fully guaranteed - then let me tell you about our sponsor Daniel Packard.

Watch this Free 45 min. Training

to learn an innovative technique that:

a) Quickly lowers your anxiety by up to 85%

b) Proves solving your anxiety can be simple.

https://www.danielpackard.com/


Do you have High Blood Pressure and/ or want to get off the Meds

Doctors are amazed at what the Zona Plus can do

$50 Discount with my Code ROY https://www.zona.com/discount/ROY


Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


1st Episodes https://learnpolish.podbean.com/page/50

======================

In this Episode we discuss:

Przyprawy – Spices

Kiedy gotuję używam przypraw- When I cook I use spices

Sól- Salt

Z solą – With salt

Bez soli- Without salt

Pieprz- Pepper

Pikantne jedzenie- Spicy food

Z pieprzem- With pepper

Bez pieprzu- Without pepper

Pieprz jest antybakteryjny- Pepper is antibacterial

Kurkuma- Turmeric

Z kurkumą - With turmeric

Bez kurkumy- Without turmeric

Herbata z miodem i kurkumą- Tea with honey and turmeric

Cynamon- Cinnamon

Z cynamonem- With cinnamon

Bez cynamonu- Without cinnamon

Pieprz cytrynowy- Lemon pepper

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish Podcast in a fun way with short Episodes. On this episode we talk about Postanowienia noworoczne - New Year's resolutions

=====

Thanks to my Sponsors for Helping Support me:

If you or know some body you know is struggling with anxiety and want to know how to be 100% anxiety free, in 6 weeks, without therapy or drugs, fully guaranteed - then let me tell you about our sponsor Daniel Packard.

Daniel Packard is a U.C. Berkeley Mechanical Engineer and his research company spent 8 years researching and testing to develop an innovative process that solves your anxiety permanently in just 6 weeks - with an astounding 90% success rate. And because their program is so effective, people who join their program only pay at the end, once they have clear, measurable results.

If you’re interested in solving your anxiety in 6 weeks - fully guaranteed - and you want to learn more and have a free consultation with Daniel, go to https://www.danielpackard.com/


Do you have High Blood Pressure and/ or want to get off the Meds

Doctors are amazed at what the Zona Plus can do

$50 Discount with my Code ROY https://www.zona.com/discount/ROY


Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


1st Episodes https://learnpolish.podbean.com/page/50

======================

In this Episode we discuss:

Zdrowy styl życia- Healthy lifestyle

Codzienny trening- Daily training

Dlaczego warto uprawiać sport? - Why is it worth doing sport?

Mam więcej energii- I have more energy

Mam lepszą kondycję- I'm in better shape

Jestem silniejsza- I'm stronger

Mam lepszy nastrój- I'm in a better mood

Jestem spokojniejsza- I am calmer

Mam lepszy metabolizm- I have a better metabolism

Nasza sylwetka jest lepsza- Our figure is better

Lepiej śpimy- We sleep better

Mogę więcej jeść- I can eat more

Jestem stabilniejsza emocjonalnie- I'm more emotionally stable

Mam więcej dyscypliny- I have more discipline

Lepsza produktywność i kreatywność- Better productivity and creativity

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish Podcast in a fun way with short Episodes. On this episode we talk about

Dlaczego warto uczyć się języka polskiego? - Why is it worth learning Polish?

=====

Thanks to my Sponsors for Helping Support me:

If you or know some body you know is struggling with anxiety and want to know how to be 100% anxiety free, in 6 weeks, without therapy or drugs, fully guaranteed - then let me tell you about our sponsor Daniel Packard.

Daniel Packard is a U.C. Berkeley Mechanical Engineer and his research company spent 8 years researching and testing to develop an innovative process that solves your anxiety permanently in just 6 weeks - with an astounding 90% success rate. And because their program is so effective, people who join their program only pay at the end, once they have clear, measurable results.

If you’re interested in solving your anxiety in 6 weeks - fully guaranteed - and you want to learn more and have a free consultation with Daniel, go to https://www.danielpackard.com/


Do you have High Blood Pressure and/ or want to get off the Meds

Doctors are amazed at what the Zona Plus can do

$50 Discount with my Code ROY https://www.zona.com/discount/ROY


Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


1st Episodes https://learnpolish.podbean.com/page/50

======================

In this Episode we discuss:

Dlaczego warto uczyć się języka polskiego? - Why is it worth learning Polish?

Łatwiej znajdziesz pracę- It's easier to find a job

Możesz studiować na polskim uniwersytecie- You can study at a Polish university

Możesz być lekarzem w Polsce- You can be a doctor in Poland

Twoje życie stanie się łatwiejsze- Your life will become easier

Będziesz bez problemu rozmawiał z lokalnymi mieszkańcami- You will have no problem talking to local people

Pokonać językową barierę- Overcome the language barrier

Poczujesz się pewniej i bardziej komfortowo w Polsce- You will feel more confident and comfortable in Poland

Poczujesz się bardziej niezależny- You will feel more independent

Dzięki językowi polskiemu możesz mieć nowe kontakty- Thanks to the Polish language you can have new contacts

Język polski pomoże ci na randce- Polish will help you on a date

Zyskasz spokój ducha- You will gain peace of mind

Zyskasz pewność siebie- You will gain self-confidence

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish Podcast in a fun way with short Episodes. On this episode we talk about

Słodycze - Sweets.

=====

Thanks to my Sponsors for Helping Support me:

If you or know some body you know is struggling with anxiety and want to know how to be 100% anxiety free, in 6 weeks, without therapy or drugs, fully guaranteed - then let me tell you about our sponsor Daniel Packard.

Daniel Packard is a U.C. Berkeley Mechanical Engineer and his research company spent 8 years researching and testing to develop an innovative process that solves your anxiety permanently in just 6 weeks - with an astounding 90% success rate. And because their program is so effective, people who join their program only pay at the end, once they have clear, measurable results.

If you’re interested in solving your anxiety in 6 weeks - fully guaranteed - and you want to learn more and have a free consultation with Daniel, go to https://www.danielpackard.com/


Do you have High Blood Pressure and/ or want to get off the Meds

Doctors are amazed at what the Zona Plus can do

$50 Discount with my Code ROY https://www.zona.com/discount/ROY


Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


1st Episodes https://learnpolish.podbean.com/page/50

======================

In this Episode we discuss:

Słodycze - Sweets

Czekolada mleczna, gorzka- Milk chocolate, dark

Cukierki- Candies

Ciasto- Cake

Sernik- Cheesecake

Szarlotka- Apple pie

Upiec ciasto- Bake a cake

Ciasteczka- Cookies

Batonik- Candy bar

Tort urodzinowy ze świeczkami- Birthday cake with candles

Lody- Ice-cream

Pączek- Donut

Liczenie kalorii- Calorie counting

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish Podcast in a fun way with short Episodes. On this episode we talk about

Miłosne zwroty - Love phrases.

=====

Thanks to my Sponsors for Helping Support me:

If you or know some body you know is struggling with anxiety and want to know how to be 100% anxiety free, in 6 weeks, without therapy or drugs, fully guaranteed - then let me tell you about our sponsor Daniel Packard.

Daniel Packard is a U.C. Berkeley Mechanical Engineer and his research company spent 8 years researching and testing to develop an innovative process that solves your anxiety permanently in just 6 weeks - with an astounding 90% success rate. And because their program is so effective, people who join their program only pay at the end, once they have clear, measurable results.

If you’re interested in solving your anxiety in 6 weeks - fully guaranteed - and you want to learn more and have a free consultation with Daniel, go to https://www.danielpackard.com/


Do you have High Blood Pressure and/ or want to get off the Meds

Doctors are amazed at what the Zona Plus can do

$50 Discount with my Code ROY https://www.zona.com/discount/ROY


Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


1st Episodes https://learnpolish.podbean.com/page/50

======================

In this Episode we discuss:

Miłosne zwroty - Love phrases

Zakochać się- Fall in love

Kochać- Love

Kocham moją żonę- I love my wife

Kogo kochasz?- Who do you Love?

Jestem zakochana / zakochany- I'm in love

Mam motylki w brzuchu- I have butterflies in my stomach

Całować się- Kiss

Zakochana para całuje się- Couple in love kissing

Przytulać- Hug

Trzymać się za ręce- Hold hands

Kawa w kawiarni- Coffee in a cafe

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish Podcast in a fun way with short Episodes. On this episode we talk about Postanowienia noworoczne - New Year's resolutions

=====

Thanks to my Sponsors for Helping Support me:

If you or know some body you know is struggling with anxiety and want to know how to be 100% anxiety free, in 6 weeks, without therapy or drugs, fully guaranteed - then let me tell you about our sponsor Daniel Packard.

Daniel Packard is a U.C. Berkeley Mechanical Engineer and his research company spent 8 years researching and testing to develop an innovative process that solves your anxiety permanently in just 6 weeks - with an astounding 90% success rate. And because their program is so effective, people who join their program only pay at the end, once they have clear, measurable results.

If you’re interested in solving your anxiety in 6 weeks - fully guaranteed - and you want to learn more and have a free consultation with Daniel, go to https://www.danielpackard.com/


Do you have High Blood Pressure and/ or want to get off the Meds

Doctors are amazed at what the Zona Plus can do

$50 Discount with my Code ROY https://www.zona.com/discount/ROY


Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


1st Episodes https://learnpolish.podbean.com/page/50

======================

In this Episode we discuss:

Postanowienia noworoczne - New Year's resolutions

Zacznę uprawiać sport- I'll start doing sports

Zacznę uczyć się polskiego- I'll start learning Polish

Zacznę liczyć kalorię- I'll start counting calories

Przestanę jeść całą paczkę orzechów- I'll stop eating a whole bag of nuts

Przestanę palić papierosy- I'll stop smoking cigarettes

Przestanę pić alkohol- I'll stop drinking alcohol

Przestanę pracować dużo- I'll stop working a lot

Odwiedzę moich znajomych- I'll visit my friends

Odwiedzę moich rodziców- I'll visit my parents

Zwiedzę nowe kraje- I will visit new countries

Zwiedzę Turcję- I will visit Turkey

Nauczę się marketingu- I will learn marketing

Nauczę się polskiej gramatyki- I will learn Polish grammar

Obejrzę sto nowych filmów- I'll watch a hundred new movies

Obejrzę dwanaście filmów w kinie- I'll watch twelve movies at the cinema

Przeczytam sto książek- I will read a hundred books

Zmienię fryzurę- I'll change my hairstyle

Zmienię styl życia- I will change my lifestyle

Zmienię pracę- I'll change my job

Chciałabym uczyć się angielskiego- I would like to learn English

Chciałabym lepiej pływać- I would like to swim better

Bój się i rób- Be afraid and do

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish Podcast in a fun way with short Episodes. On this episode we talk about Świąteczne życzenia - Christmas greetings

=====

Thanks to my Sponsors for Helping Support me:

If you or know some body you know is struggling with anxiety and want to know how to be 100% anxiety free, in 6 weeks, without therapy or drugs, fully guaranteed - then let me tell you about our sponsor Daniel Packard.

Daniel Packard is a U.C. Berkeley Mechanical Engineer and his research company spent 8 years researching and testing to develop an innovative process that solves your anxiety permanently in just 6 weeks - with an astounding 90% success rate. And because their program is so effective, people who join their program only pay at the end, once they have clear, measurable results.

If you’re interested in solving your anxiety in 6 weeks - fully guaranteed - and you want to learn more and have a free consultation with Daniel, go to https://www.danielpackard.com/


Do you have High Blood Pressure and/ or want to get off the Meds

Doctors are amazed at what the Zona Plus can do

$50 Discount with my Code ROY https://www.zona.com/discount/ROY


Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


1st Episodes https://learnpolish.podbean.com/page/50

======================

In this Episode we discuss:

Świąteczne życzenia - Christmas greetings

Kartka świąteczna- Christmas card

Składać życzenia- Make wishes

Wesołych świąt i szczęśliwego nowego roku- Merry Christmas and happy new year

Niech Święty Mikołaj przyniesie Ci wszystko o czym marzysz- May Santa Claus bring you everything you dream of

Niech Twoje serce i dom będą pełne radości- May your heart and home be full of joy

Zdrowych, spokojnych i rodzinnych świat Bożego Narodzenia- Have a healthy, peaceful and family Christmas

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish Podcast in a fun way with short Episodes. On this episode we talk about Wigilia - Christmas Eve

=====

Thanks to my Sponsors for Helping Support me:

If you or know some body you know is struggling with anxiety and want to know how to be 100% anxiety free, in 6 weeks, without therapy or drugs, fully guaranteed - then let me tell you about our sponsor Daniel Packard.

Daniel Packard is a U.C. Berkeley Mechanical Engineer and his research company spent 8 years researching and testing to develop an innovative process that solves your anxiety permanently in just 6 weeks - with an astounding 90% success rate. And because their program is so effective, people who join their program only pay at the end, once they have clear, measurable results.

If you’re interested in solving your anxiety in 6 weeks - fully guaranteed - and you want to learn more and have a free consultation with Daniel, go to https://www.danielpackard.com/


Do you have High Blood Pressure and/ or want to get off the Meds

Doctors are amazed at what the Zona Plus can do

$50 Discount with my Code ROY https://www.zona.com/discount/ROY


Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


1st Episodes https://learnpolish.podbean.com/page/50

======================

In this Episode we discuss:

Święta Bożego Narodzenia - Christmas

Wigilia - Christmas Eve

Choinka- Christmas tree

Pod choinką są prezenty- There are presents under the Christmas tree

Czy byłeś grzeczny?- Have you been good?

Pierwsza gwiazdka na niebie- The first star in the sky

Stół wigilijny- Christmas table

Święty Mikołaj- Santa Claus

Śpiewać kolędy- Sing carols

Opłatek wigilijny- Christmas wafer

Składać sobie życzenia- Make wishes

Dwanaście potraw- Twelve dishes

Pierogi z kapustą i grzybami- Dumplings with cabbage and mushrooms

Karp smażony- Fried carp

Karp w galarecie- Carp in jelly

Zupa grzybowa- Mushroom soup

Barszcz czerwony- Beetroot soup

Sernik- Cheesecake

Makowiec- Poppy seed cake

Śledzie- Herrings

Kapusta z grochem- Cabbage with peas

Potrawy postne- Lent dishes

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish Podcast in a fun way with short Episodes. On this episode we talk about

Słowa, dzięki którym zabrzmisz jak ekspert - words to make you sound like an expert

=====

Thanks to my Sponsors for Helping Support me:

If you or know some body you know is struggling with anxiety and want to know how to be 100% anxiety free, in 6 weeks, without therapy or drugs, fully guaranteed - then let me tell you about our sponsor Daniel Packard.

Daniel Packard is a U.C. Berkeley Mechanical Engineer and his research company spent 8 years researching and testing to develop an innovative process that solves your anxiety permanently in just 6 weeks - with an astounding 90% success rate. And because their program is so effective, people who join their program only pay at the end, once they have clear, measurable results.

If you’re interested in solving your anxiety in 6 weeks - fully guaranteed - and you want to learn more and have a free consultation with Daniel, go to https://www.danielpackard.com/


Do you have High Blood Pressure and/ or want to get off the Meds

Doctors are amazed at what the Zona Plus can do

$50 Discount with my Code ROY https://www.zona.com/discount/ROY


Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


1st Episodes https://learnpolish.podbean.com/page/50

======================

In this Episode we discuss:

Elokwentny- Eloquent

Zaradny- Resourceful

Równowaga- Balance

Natomiast- However

Rzeczywiście- Actually

Korzystny- Beneficial

Obfitość- Abundance

Rozwój osobisty- Personal development

Dobrostan- Well-being

Realizacja- Implementation

Konsekwencja- Consequence

Determinacja- Determination

Motywacja- Motivation

Inspiracja- Inspiration

Cele- Goals

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish Podcast in a fun way with short Episodes. On this episode we talk about

Jak wzmocnić swój polski? - How to boost your Polish?

=====

Thanks to my Sponsors for Helping Support me:

If you or know some body you know is struggling with anxiety and want to know how to be 100% anxiety free, in 6 weeks, without therapy or drugs, fully guaranteed - then let me tell you about our sponsor Daniel Packard.

Daniel Packard is a U.C. Berkeley Mechanical Engineer and his research company spent 8 years researching and testing to develop an innovative process that solves your anxiety permanently in just 6 weeks - with an astounding 90% success rate. And because their program is so effective, people who join their program only pay at the end, once they have clear, measurable results.

If you’re interested in solving your anxiety in 6 weeks - fully guaranteed - and you want to learn more and have a free consultation with Daniel, go to https://www.danielpackard.com/


Do you have High Blood Pressure and/ or want to get off the Meds

Doctors are amazed at what the Zona Plus can do

$50 Discount with my Code ROY https://www.zona.com/discount/ROY


Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


1st Episodes https://learnpolish.podbean.com/page/50

======================

In this Episode we discuss:

Jak wzmocnić swój polski? - How to boost your Polish?

Porady- Tips

Otaczaj się językiem polskim w codziennych sytuacjach- Surround yourself with Polish in everyday situations

Dołącz do naszego kursu- Join our course

Myśl po polsku- Think in Polish

Pisz pamiętnik po polsku- Write a diary in Polish

Używaj polskiego w życiu codziennym- Use Polish in everyday life

Graj w gry- Play games

Pięć nowych słów każdego dnia- Five new words every day

Słuchaj podcastów- Listen to podcasts

Zmień język w komputerze i telefonie na polski- Change the language on your computer and phone to Polish

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish Podcast in a fun way with short Episodes. On this episode we talk about

Mapa marzeń - Dream map.

=====

Thanks to my Sponsors for Helping Support me:

If you or know some body you know is struggling with anxiety and want to know how to be 100% anxiety free, in 6 weeks, without therapy or drugs, fully guaranteed - then let me tell you about our sponsor Daniel Packard.

Daniel Packard is a U.C. Berkeley Mechanical Engineer and his research company spent 8 years researching and testing to develop an innovative process that solves your anxiety permanently in just 6 weeks - with an astounding 90% success rate. And because their program is so effective, people who join their program only pay at the end, once they have clear, measurable results.

If you’re interested in solving your anxiety in 6 weeks - fully guaranteed - and you want to learn more and have a free consultation with Daniel, go to https://www.danielpackard.com/


Do you have High Blood Pressure and/ or want to get off the Meds

Doctors are amazed at what the Zona Plus can do

$50 Discount with my Code ROY https://www.zona.com/discount/ROY


Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


1st Episodes https://learnpolish.podbean.com/page/50

======================

In this Episode we discuss:

Mapa marzeń - Dream map

Ocean- Ocean

Egzotyczna wyspa- Exotic island

Samolot- Plane

Podróże- Travels

Serce, miłość- Heart, love

Relaks, odpoczynek- Relax, rest

Osiągnąć sukces- Succeed

Nowe cele- New goals

Jeść zdrowo, ćwiczyć regularnie- Eat healthy, exercise regularly

Pieniądze- Money

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish Podcast in a fun way with short Episodes. On this episode we talk about

Komplementy- Compliments.

=====

Thanks to my Sponsors for Helping Support me:

If you or know some body you know is struggling with anxiety and want to know how to be 100% anxiety free, in 6 weeks, without therapy or drugs, fully guaranteed - then let me tell you about our sponsor Daniel Packard.

Daniel Packard is a U.C. Berkeley Mechanical Engineer and his research company spent 8 years researching and testing to develop an innovative process that solves your anxiety permanently in just 6 weeks - with an astounding 90% success rate. And because their program is so effective, people who join their program only pay at the end, once they have clear, measurable results.

If you’re interested in solving your anxiety in 6 weeks - fully guaranteed - and you want to learn more and have a free consultation with Daniel, go to https://www.danielpackard.com/


Do you have High Blood Pressure and/ or want to get off the Meds

Doctors are amazed at what the Zona Plus can do

$50 Discount with my Code ROY https://www.zona.com/discount/ROY


Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


1st Episodes https://learnpolish.podbean.com/page/50

======================

In this Episode we discuss:

Komplementy- Compliments

Jesteś przepiękna- You are beautiful

Jesteś urocza- You are adorable

Jesteś śliczna- You're beautiful

Jesteś ładna- You are pretty

Jesteś atrakcyjna- You are attractive

Jesteś słodka- You're cute

Jesteś niesamowita- You are amazing

Jesteś cudowna- You are wonderful

Jesteś wspaniała- You are wonderful

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish Podcast in a fun way with short Episodes. On this episode we talk about

Jak przepraszać po polsku? - How to apologize in Polish?

=====

Thanks to my Sponsors for Helping Support me:

If you or know some body you know is struggling with anxiety and want to know how to be 100% anxiety free, in 6 weeks, without therapy or drugs, fully guaranteed - then let me tell you about our sponsor Daniel Packard.

Daniel Packard is a U.C. Berkeley Mechanical Engineer and his research company spent 8 years researching and testing to develop an innovative process that solves your anxiety permanently in just 6 weeks - with an astounding 90% success rate. And because their program is so effective, people who join their program only pay at the end, once they have clear, measurable results.

If you’re interested in solving your anxiety in 6 weeks - fully guaranteed - and you want to learn more and have a free consultation with Daniel, go to https://www.danielpackard.com/


Do you have High Blood Pressure and/ or want to get off the Meds

Doctors are amazed at what the Zona Plus can do

$50 Discount with my Code ROY https://www.zona.com/discount/ROY


Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


1st Episodes https://learnpolish.podbean.com/page/50

======================

In this Episode we discuss:

Przeprosiny- Apology

Jak przepraszać po polsku? - How to apologize in Polish?

Bardzo przepraszam- I'm very sorry

Naprawdę mi przykro- I'm really sorry

Przepraszam, to moja wina- I'm sorry it's my fault

Wybacz mi proszę- Please forgive me

Mam nadzieję, że mi wybaczysz- I hope you will forgive me

Jestem Ci winien / winna przeprosiny- I owe you an apology

To było bezmyślne z mojej strony- It was thoughtless of me

Bardzo żałuję- I really regret

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish Podcast in a fun way with short Episodes. On this episode we talk about

Jaka część nauki sprawia największą radość?- What part of learning gives you the most joy?

=====

Thanks to my Sponsors for Helping Support me:

If you or know some body you know is struggling with anxiety and want to know how to be 100% anxiety free, in 6 weeks, without therapy or drugs, fully guaranteed - then let me tell you about our sponsor Daniel Packard.

Daniel Packard is a U.C. Berkeley Mechanical Engineer and his research company spent 8 years researching and testing to develop an innovative process that solves your anxiety permanently in just 6 weeks - with an astounding 90% success rate. And because their program is so effective, people who join their program only pay at the end, once they have clear, measurable results.

If you’re interested in solving your anxiety in 6 weeks - fully guaranteed - and you want to learn more and have a free consultation with Daniel, go to https://www.danielpackard.com/


Do you have High Blood Pressure and/ or want to get off the Meds

Doctors are amazed at what the Zona Plus can do

$50 Discount with my Code ROY https://www.zona.com/discount/ROY


Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


1st Episodes https://learnpolish.podbean.com/page/50

======================

In this Episode we discuss:

Nauka języka polskiego- Learning Polish

Jaka część nauki sprawia największą radość?- What part of learning gives you the most joy?

Rozmowa w sklepie ze sprzedawcą, sprzedawczynią - Conversation in a store with a salesman

Oglądać polskie filmy- Watch Polish movies

Rozumieć polskie piosenki- Understand Polish songs

Komunikować się z polakami po polsku- Communicate with Poles in Polish

Załatwić swoje sprawy w urzędzie po polsku- Deal with your affairs at the office in Polish

Możesz szukać pracy- You can look for a job

Polska literatura, sztuka, kultura- Polish literature, art, culture

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish Podcast in a fun way with short Episodes. On this episode we talk about

Co robisz gdy pada śnieg? - What do you do when it snows?

=====

Thanks to my Sponsors for Helping Support me:

If you or know some body you know is struggling with anxiety and want to know how to be 100% anxiety free, in 6 weeks, without therapy or drugs, fully guaranteed - then let me tell you about our sponsor Daniel Packard.

Daniel Packard is a U.C. Berkeley Mechanical Engineer and his research company spent 8 years researching and testing to develop an innovative process that solves your anxiety permanently in just 6 weeks - with an astounding 90% success rate. And because their program is so effective, people who join their program only pay at the end, once they have clear, measurable results.

If you’re interested in solving your anxiety in 6 weeks - fully guaranteed - and you want to learn more and have a free consultation with Daniel, go to https://www.danielpackard.com/


Do you have High Blood Pressure and/ or want to get off the Meds

Doctors are amazed at what the Zona Plus can do

$50 Discount with my Code ROY https://www.zona.com/discount/ROY


Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


1st Episodes https://learnpolish.podbean.com/page/50

======================

In this Episode we discuss:

Co robisz gdy pada śnieg? - What do you do when it snows?

Czy Ty lubisz śnieg?- Do you like snow?

Piję gorące kakao, wino- I drink hot cocoa, wine

Piję herbatę z miodem i cytryną- I drink tea with honey and lemon

Musimy mieć ciepłą kurtkę, czapkę- We must have a warm jacket, a hat

Kupuję nowy szalik i rękawiczki- I buy a new scarf and gloves

Bawię się na śniegu z synem- I play in the snow with my son

Idę na łyżwy- I go ice skating

Jeżdżę na nartach- I ski

Nigdy nie jest za późno- It is never too late

Robić bałwana- Making a snowman

Ja morsuję- I winter swim

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish Podcast in a fun way with short Episodes. On this episode we talk about

Transport w mieście - Transport in the city

=====

Thanks to my Sponsors for Helping Support me:

If you or know some body you know is struggling with anxiety and want to know how to be 100% anxiety free, in 6 weeks, without therapy or drugs, fully guaranteed - then let me tell you about our sponsor Daniel Packard.

Daniel Packard is a U.C. Berkeley Mechanical Engineer and his research company spent 8 years researching and testing to develop an innovative process that solves your anxiety permanently in just 6 weeks - with an astounding 90% success rate. And because their program is so effective, people who join their program only pay at the end, once they have clear, measurable results.

If you’re interested in solving your anxiety in 6 weeks - fully guaranteed - and you want to learn more and have a free consultation with Daniel, go to https://www.danielpackard.com/


Do you have High Blood Pressure and/ or want to get off the Meds

Doctors are amazed at what the Zona Plus can do

$50 Discount with my Code ROY https://www.zona.com/discount/ROY


Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


1st Episodes https://learnpolish.podbean.com/page/50

======================

In this Episode we discuss:

Transport w mieście - Transport in the city

Jeżdżę autobusem- I go by bus

Jeżdżę meleksem- I go by melex

Jeżdżę rowerem- I ride a bike

Jeżdżę hulajnogą- I ride a scooter

Jeżdżę samochodem- I drive a car

Jesteś niezależny- You are independent

Możesz blisko podjechać- You can get close

Korki w mieście- Traffic jams in the city

Jeżdżę metrem- I go by subway

Jeżdżę tramwajem- I go by tram

Jeżdżę skuterem- I ride a scooter

Jeżdżę taksówką- I take a taxi

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish Podcast in a fun way with short Episodes. On this episode we talk about

Robimy coś na czas - We do something on time.

=====

Thanks to my Sponsors for Helping Support me:

If you or know some body you know is struggling with anxiety and want to know how to be 100% anxiety free, in 6 weeks, without therapy or drugs, fully guaranteed - then let me tell you about our sponsor Daniel Packard.

Daniel Packard is a U.C. Berkeley Mechanical Engineer and his research company spent 8 years researching and testing to develop an innovative process that solves your anxiety permanently in just 6 weeks - with an astounding 90% success rate. And because their program is so effective, people who join their program only pay at the end, once they have clear, measurable results.

If you’re interested in solving your anxiety in 6 weeks - fully guaranteed - and you want to learn more and have a free consultation with Daniel, go to https://www.danielpackard.com/


Do you have High Blood Pressure and/ or want to get off the Meds

Doctors are amazed at what the Zona Plus can do

$50 Discount with my Code ROY https://www.zona.com/discount/ROY


Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


1st Episodes https://learnpolish.podbean.com/page/50

======================

In this Episode we discuss:

Czas- Time

Nie mam czasu- I have no time

Robimy coś na czas - We do something on time

Muszę zrobić projekt na czas- I have to complete the project on time

Czas wolny- Free time

Zabić czas- Kill time

Czas to pieniądz-Time is money

Nie możemy marnować czasu- We can't waste time

W swoim czasie- In it's time

W odpowiednim czasie- At the appropriate time

Każde dziecko mówi w swoim czasie- Every child says in his own time

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish Podcast in a fun way with short Episodes. On this episode we talk about Porównania- Comparisons.

=====

Thanks to my Sponsors for Helping Support me:

If you or know some body you know is struggling with anxiety and want to know how to be 100% anxiety free, in 6 weeks, without therapy or drugs, fully guaranteed - then let me tell you about our sponsor Daniel Packard.

Daniel Packard is a U.C. Berkeley Mechanical Engineer and his research company spent 8 years researching and testing to develop an innovative process that solves your anxiety permanently in just 6 weeks - with an astounding 90% success rate. And because their program is so effective, people who join their program only pay at the end, once they have clear, measurable results.

If you’re interested in solving your anxiety in 6 weeks - fully guaranteed - and you want to learn more and have a free consultation with Daniel, go to https://www.danielpackard.com/


Do you have High Blood Pressure and/ or want to get off the Meds

Doctors are amazed at what the Zona Plus can do

$50 Discount with my Code ROY https://www.zona.com/discount/ROY


Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


1st Episodes https://learnpolish.podbean.com/page/50

======================

In this Episode we discuss:

Porównania - Comparisons

Smaczne jak obiad u babci- Tasty like dinner at grandma's

Czarny jak noc- Black as night

Niebieski jak niebo- Blue as the sky

Piękna jak kwiat- Beautiful like a flower

Jasne jak słońce- Bright as sun (clear as a bell)

Wysoki jak żyrafa- Tall as a giraffe

Wolny jak żółw- Free as a turtle

Mały jak mysz- Small as a mouse

Duży jak wieżowiec- Big like a skyscraper

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish Podcast in a fun way with short Episodes. On this episode we talk about Co można robić w pracy? - What can you do at work?

=====

Thanks to my Sponsors for Helping Support me:

If you or know some body you know is struggling with anxiety and want to know how to be 100% anxiety free, in 6 weeks, without therapy or drugs, fully guaranteed - then let me tell you about our sponsor Daniel Packard.

Daniel Packard is a U.C. Berkeley Mechanical Engineer and his research company spent 8 years researching and testing to develop an innovative process that solves your anxiety permanently in just 6 weeks - with an astounding 90% success rate. And because their program is so effective, people who join their program only pay at the end, once they have clear, measurable results.

If you’re interested in solving your anxiety in 6 weeks - fully guaranteed - and you want to learn more and have a free consultation with Daniel, go to https://www.danielpackard.com/


Do you have High Blood Pressure and/ or want to get off the Meds

Doctors are amazed at what the Zona Plus can do

$50 Discount with my Code ROY https://www.zona.com/discount/ROY


Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


1st Episodes https://learnpolish.podbean.com/page/50

======================

In this Episode we discuss:

Co można robić w pracy? - What can you do at work?

Robić projekty- Doing projects

Planować- Plan

Projektować- Design

Korespondować- Correspond

Pisać e-maile- Write e-mails

Robić notatki- Take notes

Rozmawiać przez telefon- Talk on the phone

Dyskutować - Discuss

Mieć spotkanie z klientami (zdalne, personalne)- Have a meeting with clients (remote, in person)

Kontakt twarzą w twarz- Face to face contact

Pić kawę, herbatę- Drink coffee, tea

Mieć przerwę- Have a break

Palić papierosy- Smoke cigarettes

Jeść obiad- Have dinner

Konsultować się- Consult

Wysyłać fax- Send fax

Rozwiązywać problemy- Solve problems

Problemy finansowe- Financial problems

Pracować na komputerze- Work on the computer

Jestem przedsiębiorcą- I am an entrepreneur

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish Podcast in a fun way with short Episodes. On this episode we talk about Objawy przeziębienia - Cold symptoms.

=====

Thanks to my Sponsors for Helping Support me:

If you or know some body you know is struggling with anxiety and want to know how to be 100% anxiety free, in 6 weeks, without therapy or drugs, fully guaranteed - then let me tell you about our sponsor Daniel Packard.

Daniel Packard is a U.C. Berkeley Mechanical Engineer and his research company spent 8 years researching and testing to develop an innovative process that solves your anxiety permanently in just 6 weeks - with an astounding 90% success rate. And because their program is so effective, people who join their program only pay at the end, once they have clear, measurable results.

If you’re interested in solving your anxiety in 6 weeks - fully guaranteed - and you want to learn more and have a free consultation with Daniel, go to https://www.danielpackard.com/


Do you have High Blood Pressure and/ or want to get off the Meds

Doctors are amazed at what the Zona Plus can do

$50 Discount with my Code ROY https://www.zona.com/discount/ROY


Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


1st Episodes https://learnpolish.podbean.com/page/50

======================

In this Episode we discuss:

Przeziębienie - Cold

Objawy przeziębienia - Cold symptoms

Czuję się słabo- I feel weak

Jestem osłabiony, osłabiona- I'm weakened

Chusteczka- Tissue

Mam katar- I have a cold

Leci mi z nosa- My nose is running

Nie mamy energii- We don't have energy

Chce nam się spać- We want to sleep

Mam kaszel- I have a cough

Boli mnie gardło- I have a sore throat

Boli mnie głowa- I have a headache

Kręci się w głowie- Feel dizzy

Nie mam na nic ochoty- I don't feel like doing anything

Nie mam apetytu- I have no appetite

Mieć gorączkę- To have a fever

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish Podcast in a fun way with short Episodes. On this episode we talk about

Jak dbać o zdrowie? - How to take care of your health?.

=====

Thanks to my Sponsors for Helping Support me:

If you or know some body you know is struggling with anxiety and want to know how to be 100% anxiety free, in 6 weeks, without therapy or drugs, fully guaranteed - then let me tell you about our sponsor Daniel Packard.

Daniel Packard is a U.C. Berkeley Mechanical Engineer and his research company spent 8 years researching and testing to develop an innovative process that solves your anxiety permanently in just 6 weeks - with an astounding 90% success rate. And because their program is so effective, people who join their program only pay at the end, once they have clear, measurable results.

If you’re interested in solving your anxiety in 6 weeks - fully guaranteed - and you want to learn more and have a free consultation with Daniel, go to https://www.danielpackard.com/


Do you have High Blood Pressure and/ or want to get off the Meds

Doctors are amazed at what the Zona Plus can do

$50 Discount with my Code ROY https://www.zona.com/discount/ROY


Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


1st Episodes https://learnpolish.podbean.com/page/50

======================

In this Episode we discuss:

Zdrowie- Health

Jak dbać o zdrowie? - How to take care of your health?

Zdrowa dieta- Healthy diet

Dziki łosoś- Wild salmon

Łosoś hodowlany- Farmed salmon

Ćwiczenia fizyczne- Physical exercise

Czy Ty ćwiczysz regularnie?- Do you exercise regularly?

Ćwiczę na siłowni- I work out at the gym

Chodzę do sauny- I go to the sauna

Pozytywne myślenie- Positive thinking

Sen- Sleep

Spać minimum osiem godzin- Sleep at least eight hours

Odpoczynek- Rest

Praca do ośmiu godzin- Work up to eight hours

Ruch i spacery- Movement and walking

Czas dla siebie- Time for yourself

Iść na randkę- Go on a date

Równowaga w życiu- Balance in life

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish Podcast in a fun way with short Episodes. On this episode we talk about

U dentysty - At the dentist ).

=====

Thanks to my Sponsors for Helping Support me:

If you or know some body you know is struggling with anxiety and want to know how to be 100% anxiety free, in 6 weeks, without therapy or drugs, fully guaranteed - then let me tell you about our sponsor Daniel Packard.

Daniel Packard is a U.C. Berkeley Mechanical Engineer and his research company spent 8 years researching and testing to develop an innovative process that solves your anxiety permanently in just 6 weeks - with an astounding 90% success rate. And because their program is so effective, people who join their program only pay at the end, once they have clear, measurable results.

If you’re interested in solving your anxiety in 6 weeks - fully guaranteed - and you want to learn more and have a free consultation with Daniel, go to https://www.danielpackard.com/


Do you have High Blood Pressure and/ or want to get off the Meds

Doctors are amazed at what the Zona Plus can do

$50 Discount with my Code ROY https://www.zona.com/discount/ROY


Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


1st Episodes https://learnpolish.podbean.com/page/50

======================

In this Episode we discuss:

U dentysty - At the dentist

Dentysta, dentystka- Dentist

Czy boisz się chodzić do dentysty?- Are you afraid of going to the dentist?

Dentysta dba o nasze zęby- The dentist takes care of our teeth

Gabinet stomatologiczny- Dentist

Boli mnie ząb- My tooth hurts

Bolą mnie zęby- My teeth hurt

Wyleczyć ząb- Treat a tooth

Wyrwać ząb- Pull a tooth

Zęby mleczne - Milk teeth

Ząb mądrości- Wisdom tooth

Ząb jest zepsuty- The tooth is rotten

Borować zęby- Drill your teeth

Zakładać plombę- Put on a filling

Wybielić zęby- Whiten your teeth

Cudowny uśmiech- Wonderful smile

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Poranna toaleta (higiena) - Morning toilet (hygiene).

=====

Thanks to my Sponsors for Helping Support me:

If you or know some body you know is struggling with anxiety and want to know how to be 100% anxiety free, in 6 weeks, without therapy or drugs, fully guaranteed - then let me tell you about our sponsor Daniel Packard.

Daniel Packard is a U.C. Berkeley Mechanical Engineer and his research company spent 8 years researching and testing to develop an innovative process that solves your anxiety permanently in just 6 weeks - with an astounding 90% success rate. And because their program is so effective, people who join their program only pay at the end, once they have clear, measurable results.

If you’re interested in solving your anxiety in 6 weeks - fully guaranteed - and you want to learn more and have a free consultation with Daniel, go to https://www.danielpackard.com/


Do you have High Blood Pressure and/ or want to get off the Meds

Doctors are amazed at what the Zona Plus can do

$50 Discount with my Code ROY https://www.zona.com/discount/ROY


Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


1st Episodes https://learnpolish.podbean.com/page/50

======================

In this Episode we discuss:

Poranna toaleta (higiena) - Morning toilet (hygiene)

Łazienka (w łazience)- Bathroom (in the bathroom)

Brać prysznic- Take a shower

Kąpać się w wannie- Take a bath

Myć się wodą i mydłem- Wash with water and soap

Żel pod prysznic- Shower gel

Mydło w kostce- Bar soap

Myć zęby- Brush your teeth

Pasta do zębów i szczoteczka do zębów- Toothpaste and toothbrush

Ręcznik- Towel

Ciepły kaloryfer- Warm radiator

Wycierać ciało ręcznikiem- Dry the body with a towel

Szampon do włosów- Shampoo

Odżywka do włosów- Hair conditioner

Suszyć włosy- Dry hair

Suszarka do włosów- Hair dryer

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Polish quiz - Polski quiz.

=====

Thanks to my Sponsors for Helping Support me:

If you or know some body you know is struggling with anxiety and want to know how to be 100% anxiety free, in 6 weeks, without therapy or drugs, fully guaranteed - then let me tell you about our sponsor Daniel Packard.

Daniel Packard is a U.C. Berkeley Mechanical Engineer and his research company spent 8 years researching and testing to develop an innovative process that solves your anxiety permanently in just 6 weeks - with an astounding 90% success rate. And because their program is so effective, people who join their program only pay at the end, once they have clear, measurable results.

If you’re interested in solving your anxiety in 6 weeks - fully guaranteed - and you want to learn more and have a free consultation with Daniel, go to https://www.danielpackard.com/


Do you have High Blood Pressure and/ or want to get off the Meds

Doctors are amazed at what the Zona Plus can do

$50 Discount with my Code ROY https://www.zona.com/discount/ROY


Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


1st Episodes https://learnpolish.podbean.com/page/50

======================

In this Episode we discuss:

Pierogi ruskie to popularne polskie danie - Pierogi ruskie is a popular Polish dish

Krzysztof Penderecki to polski kompozytor- Krzysztof Penderecki is a Polish composer

Żubrówka to polska wódka- Żubrówka is a Polish vodka

Kościół Mariacki to kościół w Krakowie- St. Mary's Church is a church in Krakow

Wawel to zamek w Krakowie- Wawel is a castle in Krakow

Śląsk to region przemysłowy na południu Polski- Silesia is an industrial region in the south of Poland

Gniezno to pierwsza stolica Polski- Gniezno is the first capital of Poland

Karol Wojtyła to papież- Karol Wojtyła is the pope

Maluch to polski fiat- Maluch is a Polish Fiat

Solidarność to związek zawodowy- Solidarity is a trade union

Krzysztof Kieślowski to polski reżyser- Krzysztof Kieślowski is a Polish director

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Uczucia - Feelings.

=====

Thanks to my Sponsors for Helping Support me:

If you or know some body you know is struggling with anxiety and want to know how to be 100% anxiety free, in 6 weeks, without therapy or drugs, fully guaranteed - then let me tell you about our sponsor Daniel Packard.

Daniel Packard is a U.C. Berkeley Mechanical Engineer and his research company spent 8 years researching and testing to develop an innovative process that solves your anxiety permanently in just 6 weeks - with an astounding 90% success rate. And because their program is so effective, people who join their program only pay at the end, once they have clear, measurable results.

If you’re interested in solving your anxiety in 6 weeks - fully guaranteed - and you want to learn more and have a free consultation with Daniel, go to https://www.danielpackard.com/


Do you have High Blood Pressure and/ or want to get off the Meds

Doctors are amazed at what the Zona Plus can do

$50 Discount with my Code ROY https://www.zona.com/discount/ROY


Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


1st Episodes https://learnpolish.podbean.com/page/50

======================

In this Episode we discuss:

Uczucia- Feelings

Czuję ulgę- I feel relieved

Czuję radość- I feel joy

Czuję niepokój- I feel anxiety

Czuję strach- I feel fear

Czuję satysfakcję- I feel satisfied

Czuję wstyd- I feel ashamed

Czuję smutek- I feel sad

Czuję zazdrość- I feel jealous

Czuję spokój- I feel peace

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Owady - Insects.

=====

Thanks to my Sponsors for Helping Support me:

If you or know some body you know is struggling with anxiety and want to know how to be 100% anxiety free, in 6 weeks, without therapy or drugs, fully guaranteed - then let me tell you about our sponsor Daniel Packard.

Daniel Packard is a U.C. Berkeley Mechanical Engineer and his research company spent 8 years researching and testing to develop an innovative process that solves your anxiety permanently in just 6 weeks - with an astounding 90% success rate. And because their program is so effective, people who join their program only pay at the end, once they have clear, measurable results.

If you’re interested in solving your anxiety in 6 weeks - fully guaranteed - and you want to learn more and have a free consultation with Daniel, go to https://www.danielpackard.com/


Do you have High Blood Pressure and/ or want to get off the Meds

Doctors are amazed at what the Zona Plus can do

$50 Discount with my Code ROY https://www.zona.com/discount/ROY


Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


1st Episodes https://learnpolish.podbean.com/page/50

======================

In this Episode we discuss:

Owady - Insects

Bać się owadów- Be afraid of insects

Motyl- Butterfly

Ćma- Moth

Komary- Mosquitos

Pająk- Spider

Zabić pająka- Kill the spider

Mucha- Fly

Pszczoła- Bee

Miód- Honey

Biedronka- Ladybird

Mrówka- Ant

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Rodzaje sklepów - Types of shops.

=====

Thanks to my Sponsors for Helping Support me:

If you or know some body you know is struggling with anxiety and want to know how to be 100% anxiety free, in 6 weeks, without therapy or drugs, fully guaranteed - then let me tell you about our sponsor Daniel Packard.

Daniel Packard is a U.C. Berkeley Mechanical Engineer and his research company spent 8 years researching and testing to develop an innovative process that solves your anxiety permanently in just 6 weeks - with an astounding 90% success rate. And because their program is so effective, people who join their program only pay at the end, once they have clear, measurable results.

If you’re interested in solving your anxiety in 6 weeks - fully guaranteed - and you want to learn more and have a free consultation with Daniel, go to https://www.danielpackard.com/


Do you have High Blood Pressure and/ or want to get off the Meds

Doctors are amazed at what the Zona Plus can do

$50 Discount with my Code ROY https://www.zona.com/discount/ROY


Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


1st Episodes https://learnpolish.podbean.com/page/50

======================

In this Episode we discuss:

Rodzaje sklepów - Types of shops

Sklep spożywczy- Grocery shop

Sklep odzieżowy- Clothes shop

Sklep obuwniczy- Shoe shop

Księgarnia- Bookstore

Kwiaciarnia- Florist's

Sklep z pamiątkami- Souvenir shop

Sklep zoologiczny- Pet Shop

Sklep z zabawkami- Toy shop

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

W restauracji - In the restaurant.

=====

Thanks to my Sponsors for Helping Support me:

If you or know some body you know is struggling with anxiety and want to know how to be 100% anxiety free, in 6 weeks, without therapy or drugs, fully guaranteed - then let me tell you about our sponsor Daniel Packard.

Daniel Packard is a U.C. Berkeley Mechanical Engineer and his research company spent 8 years researching and testing to develop an innovative process that solves your anxiety permanently in just 6 weeks - with an astounding 90% success rate. And because their program is so effective, people who join their program only pay at the end, once they have clear, measurable results.

If you’re interested in solving your anxiety in 6 weeks - fully guaranteed - and you want to learn more and have a free consultation with Daniel, go to https://www.danielpackard.com/


Do you have High Blood Pressure and/ or want to get off the Meds

Doctors are amazed at what the Zona Plus can do

$50 Discount with my Code ROY https://www.zona.com/discount/ROY


Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


1st Episodes https://learnpolish.podbean.com/page/50

======================

In this Episode we discuss:

W restauracji -In the restaurant

Kelner, kelnerka- Waiter, waitress

Oni opiekują się nami- They take care of us

Napiwek- Tip

Szef kuchni- Chef

Zarezerwować stolik- Reserve a table

Potrawa- Dish

Zamówić jedzenie- Order food

Sztućce (łyżka, nóż, widelec)- Cutlery (spoon, knife, fork)

Co do picia?- What to drink?

Napoje- Drinks

Wino dobrej jakości- Good quality wine

Strefa dla palących- Smoking area

Smacznego- Enjoy your meal

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Przestępstwa - Crimes.

=====

Thanks to my Sponsors for Helping Support me:

If you or know some body you know is struggling with anxiety and want to know how to be 100% anxiety free, in 6 weeks, without therapy or drugs, fully guaranteed - then let me tell you about our sponsor Daniel Packard.

Daniel Packard is a U.C. Berkeley Mechanical Engineer and his research company spent 8 years researching and testing to develop an innovative process that solves your anxiety permanently in just 6 weeks - with an astounding 90% success rate. And because their program is so effective, people who join their program only pay at the end, once they have clear, measurable results.

If you’re interested in solving your anxiety in 6 weeks - fully guaranteed - and you want to learn more and have a free consultation with Daniel, go to https://www.danielpackard.com/


Do you have High Blood Pressure and/ or want to get off the Meds

Doctors are amazed at what the Zona Plus can do

$50 Discount with my Code ROY https://www.zona.com/discount/ROY


A safe and secure way to buy and sell crypto claimshttps://cryptoclaims.pro/


Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


1st Episodes https://learnpolish.podbean.com/page/50

======================

In this Episode we discuss:

Przestępstwa - Crimes

Przestępca, przestępczyni- Criminal

Morderstwo- Murder

Zabić- Kill

Kradzież- Theft

Złodziej- Thief

Włamanie- Burglary

Oszustwo- Fraud

Oszukać- Cheat

Przekroczenie prędkości- Exceeding the speed limit

Napad- Attack

Pobicie- Beating

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Komisariat policji - Police station.

=====

Thanks to my Sponsors for Helping Support me:

If you or know some body you know is struggling with anxiety and want to know how to be 100% anxiety free, in 6 weeks, without therapy or drugs, fully guaranteed - then let me tell you about our sponsor Daniel Packard.

Daniel Packard is a U.C. Berkeley Mechanical Engineer and his research company spent 8 years researching and testing to develop an innovative process that solves your anxiety permanently in just 6 weeks - with an astounding 90% success rate. And because their program is so effective, people who join their program only pay at the end, once they have clear, measurable results.

If you’re interested in solving your anxiety in 6 weeks - fully guaranteed - and you want to learn more and have a free consultation with Daniel, go to https://www.danielpackard.com/


Do you have High Blood Pressure and/ or want to get off the Meds

Doctors are amazed at what the Zona Plus can do

$50 Discount with my Code ROY https://www.zona.com/discount/ROY


A safe and secure way to buy and sell crypto claimshttps://cryptoclaims.pro/


Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Policja- Police

Komisariat policji - Police station

Ofiara- Victim

Policjant, policjantka- Policeman, policewoman

Radiowóz policyjny- Police car

Coś złego się stanie- Something bad is going to happen

Wypadek samochodowy- Car accident

Kierować ruchem- To control the traffic

Karetka pogotowia- Ambulance

Kierować ruchem- To control the traffic

Limit prędkości- Speed limit

Dostać mandat- Get a ticket

Dbać o bezpieczeństwo- Take care of your safety

Pies policyjny- Police dog

Szukać narkotyków- Look for drugs

Drogówka- Traffic police

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Domowa apteczka - Home first aid kit.

=====

Thanks to my Sponsors for Helping Support me:

If you or know some body you know is struggling with anxiety and want to know how to be 100% anxiety free, in 6 weeks, without therapy or drugs, fully guaranteed - then let me tell you about our sponsor Daniel Packard.

Daniel Packard is a U.C. Berkeley Mechanical Engineer and his research company spent 8 years researching and testing to develop an innovative process that solves your anxiety permanently in just 6 weeks - with an astounding 90% success rate. And because their program is so effective, people who join their program only pay at the end, once they have clear, measurable results.

If you’re interested in solving your anxiety in 6 weeks - fully guaranteed - and you want to learn more and have a free consultation with Daniel, go to https://www.danielpackard.com/


Do you have High Blood Pressure and/ or want to get off the Meds

Doctors are amazed at what the Zona Plus can do

$50 Discount with my Code ROY https://www.zona.com/discount/ROY


A safe and secure way to buy and sell crypto claimshttps://cryptoclaims.pro/


Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Sezon infekcyjny- Infectious season

Domowa apteczka- Home first aid kit

Maść- Ointment

Smarować oparzenia- Lubricate burns

Termometr- Thermometer

Mierzyć temperaturę- To measure the temperature

Syrop na kaszel- Cough syrup

Strzykawka- Syringe

Robić szczepienie- Do vaccination

Robić zastrzyk- To make injection

Plaster- Patch

Naklejać plaster na zranione miejsce- Apply the patch to the injured area

Zioła- Herbs

Parzyć zioła- Brew herbs

Tabletki (pigułki)- Tablets (pills)

Brać tabletki przeciwbólowe- Take painkillers

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Kto pracuje w szpitalu? - Who works in the hospital?

=====

Thanks to my Sponsors for Helping Support me:

If you or know some body you know is struggling with anxiety and want to know how to be 100% anxiety free, in 6 weeks, without therapy or drugs, fully guaranteed - then let me tell you about our sponsor Daniel Packard.

Daniel Packard is a U.C. Berkeley Mechanical Engineer and his research company spent 8 years researching and testing to develop an innovative process that solves your anxiety permanently in just 6 weeks - with an astounding 90% success rate. And because their program is so effective, people who join their program only pay at the end, once they have clear, measurable results.

If you’re interested in solving your anxiety in 6 weeks - fully guaranteed - and you want to learn more and have a free consultation with Daniel, go to https://www.danielpackard.com/


Do you have High Blood Pressure and/ or want to get off the Meds

Doctors are amazed at what the Zona Plus can do

$50 Discount with my Code ROY https://www.zona.com/discount/ROY


A safe and secure way to buy and sell crypto claimshttps://cryptoclaims.pro/


Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Kto pracuje w szpitalu? - Who works in the hospital?

Lekarz, lekarka- Doctor

Opiekować, zajmować się pacjentami- Take care of patients

Pielęgniarz, pielęgniarka- Nurse

Pacjent, pacjentka- Patient

Izba przyjęć- Emergency room

Bardzo duże kolejki- Very long queues

Karetka- Ambulance

Pacjent leży na łóżku szpitalnym- The patient lies on a hospital bed

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Animal Comparisons - Porównania zwierząt.

=====

Thanks to my Sponsors for Helping Support me:

If you or know some body you know is struggling with anxiety and want to know how to be 100% anxiety free, in 6 weeks, without therapy or drugs, fully guaranteed - then let me tell you about our sponsor Daniel Packard.

Daniel Packard is a U.C. Berkeley Mechanical Engineer and his research company spent 8 years researching and testing to develop an innovative process that solves your anxiety permanently in just 6 weeks - with an astounding 90% success rate. And because their program is so effective, people who join their program only pay at the end, once they have clear, measurable results.

If you’re interested in solving your anxiety in 6 weeks - fully guaranteed - and you want to learn more and have a free consultation with Daniel, go to https://www.danielpackard.com/


Do you have High Blood Pressure and/ or want to get off the Meds

Doctors are amazed at what the Zona Plus can do

$50 Discount with my Code ROY https://www.zona.com/discount/ROY


A safe and secure way to buy and sell crypto claimshttps://cryptoclaims.pro/


Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Mądry jak sowa -Wise as an owl

Nocna sowa- Night owl

Powolny jak żółw- Slow as a turtle

Szybki jak gepard- Fast as a cheetah

Radosny jak skowronek- Happy as a lark

Odważny jak lew- Brave as a lion

Uparty jak osioł- Stubborn as a donkey

Sprytny jak lis- Smart as a fox

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Czynności w kuchni - Activities in the kitchen.

=====

Thanks to my Sponsors for Helping Support me:

If you or know some body you know is struggling with anxiety and want to know how to be 100% anxiety free, in 6 weeks, without therapy or drugs, fully guaranteed - then let me tell you about our sponsor Daniel Packard.

Daniel Packard is a U.C. Berkeley Mechanical Engineer and his research company spent 8 years researching and testing to develop an innovative process that solves your anxiety permanently in just 6 weeks - with an astounding 90% success rate. And because their program is so effective, people who join their program only pay at the end, once they have clear, measurable results.

If you’re interested in solving your anxiety in 6 weeks - fully guaranteed - and you want to learn more and have a free consultation with Daniel, go to https://www.danielpackard.com/


Do you have High Blood Pressure and/ or want to get off the Meds

Doctors are amazed at what the Zona Plus can do

$50 Discount with my Code ROY https://www.zona.com/discount/ROY


A safe and secure way to buy and sell crypto claimshttps://cryptoclaims.pro/


Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Czynności w kuchni- Activities in the kitchen

Kroić nożem- Cut with a knife

Kroić marchew, ziemniaki, pomidory- Cut carrots, potatoes, tomatoes

Mieszać zupę, ciasto- Stir soup, dough

Próbować zupę - Try the soup

Sprawdzić czy trzeba doprawić- Check if you need to season it

Smażyć jajka, mięso- Fry eggs, meat

Piec pizzę, ciasto- Bake pizza, cake

Obierać warzywa, ziemniaki, marchew- Peel vegetables, potatoes, carrots

Gotować spaghetti z krewetkami- Cook spaghetti with shrimps

Robię makaron- I'm making pasta

Używać miksera- Use a mixer

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Porady jak mówić po polsku szybko - Tips on how to speak Polish fast .

=====

Thanks to my Sponsors for Helping Support me:

If you or know some body you know is struggling with anxiety and want to know how to be 100% anxiety free, in 6 weeks, without therapy or drugs, fully guaranteed - then let me tell you about our sponsor Daniel Packard.

Daniel Packard is a U.C. Berkeley Mechanical Engineer and his research company spent 8 years researching and testing to develop an innovative process that solves your anxiety permanently in just 6 weeks - with an astounding 90% success rate. And because their program is so effective, people who join their program only pay at the end, once they have clear, measurable results.

If you’re interested in solving your anxiety in 6 weeks - fully guaranteed - and you want to learn more and have a free consultation with Daniel, go to https://www.danielpackard.com/


Do you have High Blood Pressure and/ or want to get off the Meds

Doctors are amazed at what the Zona Plus can do

$50 Discount with my Code ROY https://www.zona.com/discount/ROY

—-----------------------------

Quality Polish manufacturer of Metal Products for Telecommunication + workshop equipment and other metal articles.

Brochure https://bit.ly/ROY-partnercode . Let us know if you would like a quotation shipped internationally and very competitive rates


Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Porady jak mówić po polsku szybko - Tips on how to speak Polish fast

Zadawaj pytania - Ask questions

Słuchanie muzyki po polsku - Listening to music in Polish

Oglądanie filmów po polsku lub z polskimi napisami - Watching movies in Polish or with Polish subtitles

Notowanie nowych słówek - Memorizing new words

Gry planszowe, karty - Board games, cards

Motywuj siebie - Motivate yourself

Być wśród pozytywnych ludzi - Be among positive people

Kontakt z Polakami - Contact with Poles

Przyjedź do polski - Come to Poland

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Zeszyt marzeń - Dream notebook.

=====

Thanks to my Sponsors for Helping Support me:

If you or know some body you know is struggling with anxiety and want to know how to be 100% anxiety free, in 6 weeks, without therapy or drugs, fully guaranteed - then let me tell you about our sponsor Daniel Packard.

Daniel Packard is a U.C. Berkeley Mechanical Engineer and his research company spent 8 years researching and testing to develop an innovative process that solves your anxiety permanently in just 6 weeks - with an astounding 90% success rate. And because their program is so effective, people who join their program only pay at the end, once they have clear, measurable results.

If you’re interested in solving your anxiety in 6 weeks - fully guaranteed - and you want to learn more and have a free consultation with Daniel, go to https://www.danielpackard.com/


Do you have High Blood Pressure and/ or want to get off the Meds

Doctors are amazed at what the Zona Plus can do

$50 Discount with my Code ROY https://www.zona.com/discount/ROY


Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Marzyć -Dream

Zeszyt marzeń - Dream notebook

Piszemy w zeszycie nasze marzenia- We write our dreams in a notebook

Kariera i biznes- Career and business

Edukacja i rozwój- Education and development

Rozwój intelektualny- Intellectual development

Zdrowie- Health

Związek i miłość- Relationship and love

Rozwój osobisty- Personal development

Rozwój duchowy- Spiritual development

Rodzina- Family

Przyjaciele- Friends

Towarzystwo- Company

Pieniądze- Money

Czas wolny- Free time

Odpoczynek- Rest

Twoje otoczenie- Your surroundings

Mówimy w czasie teraźniejszym- We speak in the present tense

Mam dużo klientów- I have a lot of clients

Mówię fantastycznie po polsku i hiszpańsku- I speak fantastic Polish and Spanish

Jestem bardzo silny i zdrowy- I am very strong and healthy

Moja kobieta jest najpiękniejsza na świecie- My woman is the most beautiful in the world

Codziennie uczę się czegoś nowego - I learn something new every day

Jestem blisko z moją rodziną- I'm close to my family

Zarabiam dwanaście milionów rocznie- I make twelve million a year

Mam dom gdzie jest dużo kwiatów- I have a house with a lot of flowers

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Prezenty z Polski - Gifts from Poland.

=====

Thanks to my Sponsors for Helping Support me:

If you or know some body you know is struggling with anxiety and want to know how to be 100% anxiety free, in 6 weeks, without therapy or drugs, fully guaranteed - then let me tell you about our sponsor Daniel Packard.

Daniel Packard is a U.C. Berkeley Mechanical Engineer and his research company spent 8 years researching and testing to develop an innovative process that solves your anxiety permanently in just 6 weeks - with an astounding 90% success rate. And because their program is so effective, people who join their program only pay at the end, once they have clear, measurable results.

If you’re interested in solving your anxiety in 6 weeks - fully guaranteed - and you want to learn more and have a free consultation with Daniel, go to https://www.danielpackard.com/


Do you have High Blood Pressure and/ or want to get off the Meds

Doctors are amazed at what the Zona Plus can do

$50 Discount with my Code ROY https://www.zona.com/discount/ROY

—-----------------------------

Quality Polish manufacturer of Metal Products for Telecommunication + workshop equipment and other metal articles.

Brochure https://bit.ly/ROY-partnercode . Let us know if you would like a quotation shipped internationally and very competitive rates


Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Prezenty z Polski - Gifts from Poland

Co mogą turyści przywieźć z Polski?- What can tourists bring from Poland?

Bombka dekoracyjna, ręcznie malowana - Decorative bauble, hand-painted

Ptasie mleczko- Marshmallow

Czekoladowy, waniliowy smak- Chocolate, vanilla flavor

Miód naturalny- Natural honey

Biżuteria z bursztynem- Amber jewelry

Ręcznie malowana porcelana- Hand-painted porcelain

Poduszka folkowa- Folk pillow

Torba bawełniana z napisem- Cotton bag with the inscription

Pierogi- Dumplings

Bigos- Hunter's stew

Żurek- Sour soup

Polska wódka- Polish vodka

Alkohol- Alcohol

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Wszystkiego najlepszego - All the best.

=====

Thanks to my Sponsors for Helping Support me:

If you or know some body you know is struggling with anxiety and want to know how to be 100% anxiety free, in 6 weeks, without therapy or drugs, fully guaranteed - then let me tell you about our sponsor Daniel Packard.

Daniel Packard is a U.C. Berkeley Mechanical Engineer and his research company spent 8 years researching and testing to develop an innovative process that solves your anxiety permanently in just 6 weeks - with an astounding 90% success rate. And because their program is so effective, people who join their program only pay at the end, once they have clear, measurable results.

If you’re interested in solving your anxiety in 6 weeks - fully guaranteed - and you want to learn more and have a free consultation with Daniel, go to https://www.danielpackard.com/


Do you have High Blood Pressure and/ or want to get off the Meds

Doctors are amazed at what the Zona Plus can do

$50 Discount with my Code ROY https://www.zona.com/discount/ROY

—-----------------------------

Quality Polish manufacturer of Metal Products for Telecommunication + workshop equipment and other metal articles.

Brochure https://bit.ly/ROY-partnercode . Let us know if you would like a quotation shipped internationally and very competitive rates


Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Learn Polish in a fun way with short Episodes. On this episode we talk about

Sprzęty i akcesoria w ogrodzie - Equipment and accessories in the garden.

=====

Thanks to my Sponsors for Helping Support me:

If you or know some body you know is struggling with anxiety and want to know how to be 100% anxiety free, in 6 weeks, without therapy or drugs, fully guaranteed - then let me tell you about our sponsor Daniel Packard.

Daniel Packard is a U.C. Berkeley Mechanical Engineer and his research company spent 8 years researching and testing to develop an innovative process that solves your anxiety permanently in just 6 weeks - with an astounding 90% success rate. And because their program is so effective, people who join their program only pay at the end, once they have clear, measurable results.

If you’re interested in solving your anxiety in 6 weeks - fully guaranteed - and you want to learn more and have a free consultation with Daniel, go to https://www.danielpackard.com/


Do you have High Blood Pressure and/ or want to get off the Meds

Doctors are amazed at what the Zona Plus can do

$50 Discount with my Code ROY https://www.zona.com/discount/ROY

—-----------------------------

Quality Polish manufacturer of Metal Products for Telecommunication + workshop equipment and other metal articles.

Brochure https://bit.ly/ROY-partnercode . Let us know if you would like a quotation shipped internationally and very competitive rates


Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Wszystkiego najlepszego- All the best

To jest Roy- This is Roy

Prezent dla Roya- A gift for Roy

Ufam Royowi- I trust Roy

Lubię Roya- I like Roy

Rozmawiam z Royem- I am talking to Roy

Myślę o Royu- I am thinking about Roy

Witaj Roy- Welcome, Hello Roy

Sto lat - Happy birthday

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Jak celebrujesz swoje urodziny? - How do you celebrate your birthday?.

=====

Thanks to my Sponsors for Helping Support me:

If you or know some body you know is struggling with anxiety and want to know how to be 100% anxiety free, in 6 weeks, without therapy or drugs, fully guaranteed - then let me tell you about our sponsor Daniel Packard.

Daniel Packard is a U.C. Berkeley Mechanical Engineer and his research company spent 8 years researching and testing to develop an innovative process that solves your anxiety permanently in just 6 weeks - with an astounding 90% success rate. And because their program is so effective, people who join their program only pay at the end, once they have clear, measurable results.

If you’re interested in solving your anxiety in 6 weeks - fully guaranteed - and you want to learn more and have a free consultation with Daniel, go to https://www.danielpackard.com/


Do you have High Blood Pressure and/ or want to get off the Meds

Doctors are amazed at what the Zona Plus can do

$50 Discount with my Code ROY https://www.zona.com/discount/ROY

—-----------------------------

Quality Polish manufacturer of Metal Products for Telecommunication + workshop equipment and other metal articles.

Brochure https://bit.ly/ROY-partnercode . Let us know if you would like a quotation shipped internationally and very competitive rates


Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Urodziny- Birthday

Celebrować- Celebrate

Jak celebrujesz swoje urodziny?- How do you celebrate your birthday?

Tort urodzinowy- Birthday cake

Świeczki- Candles

Czy lubisz dostawać prezenty? - Do you like receiving gifts?

Ubranie sportowe- Sport suit

Dres sportowy - Sports tracksuit

Praktyczne prezenty- Practical gifts

Możemy iść do pubu- We can go to the pub

Możemy spotkać się ze znajomymi- We can meet friends

Impreza niespodzianka- Surprise party

Idę do restauracji- I'm going to a restaurant

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Sprzęty i akcesoria w ogrodzie - Equipment and accessories in the garden.

=====

Thanks to my Sponsors for Helping Support me:

If you or know some body you know is struggling with anxiety and want to know how to be 100% anxiety free, in 6 weeks, without therapy or drugs, fully guaranteed - then let me tell you about our sponsor Daniel Packard.

Daniel Packard is a U.C. Berkeley Mechanical Engineer and his research company spent 8 years researching and testing to develop an innovative process that solves your anxiety permanently in just 6 weeks - with an astounding 90% success rate. And because their program is so effective, people who join their program only pay at the end, once they have clear, measurable results.

If you’re interested in solving your anxiety in 6 weeks - fully guaranteed - and you want to learn more and have a free consultation with Daniel, go to https://www.danielpackard.com/


Do you have High Blood Pressure and/ or want to get off the Meds

Doctors are amazed at what the Zona Plus can do

$50 Discount with my Code ROY https://www.zona.com/discount/ROY

—-----------------------------

Quality Polish manufacturer of Metal Products for Telecommunication + workshop equipment and other metal articles.

Brochure https://bit.ly/ROY-partnercode . Let us know if you would like a quotation shipped internationally and very competitive rates


Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Sprzęty i akcesoria w ogrodziem - Equipment and accessories in the garden

Chwasty- Weeds

Taczka- Wheelbarrow

Można transportować ziemię, trawę- You can transport soil, grass

Wiadro- Bucket

We wiadrze można trzymać wodę, śmieci- You can keep water in a bucket, garbage

Łopatka i grabki- Shovel and rake

Możemy pielić chwasty- We can weed the weeds

Można usuwać starą trawę grabkami- You can remove old grass with a rake

Konewka- Watering can

Można podlewać kwiaty konewką- You can water flowers with a watering can

Szpadel- Spade

Można kopać dziury szpadlem- You can dig holes with a spade

Kosiarka - Lawnmower

Można kosić trawę kosiarką- You can cut the grass with a lawn mower

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Kto rano wstaje, temu Pan Bóg daje - Whoever gets up in the morning, God gives him.

=====

Thanks to my Sponsors for Helping Support me:

If you or know some body you know is struggling with anxiety and want to know how to be 100% anxiety free, in 6 weeks, without therapy or drugs, fully guaranteed - then let me tell you about our sponsor Daniel Packard.

Daniel Packard is a U.C. Berkeley Mechanical Engineer and his research company spent 8 years researching and testing to develop an innovative process that solves your anxiety permanently in just 6 weeks - with an astounding 90% success rate. And because their program is so effective, people who join their program only pay at the end, once they have clear, measurable results.

If you’re interested in solving your anxiety in 6 weeks - fully guaranteed - and you want to learn more and have a free consultation with Daniel, go to https://www.danielpackard.com/


Do you have High Blood Pressure and/ or want to get off the Meds

Doctors are amazed at what the Zona Plus can do

$50 Discount with my Code ROY https://www.zona.com/discount/ROY

—-----------------------------

Quality Polish manufacturer of Metal Products for Telecommunication + workshop equipment and other metal articles.

Brochure https://bit.ly/ROY-partnercode . Let us know if you would like a quotation shipped internationally and very competitive rates


Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Kto rano wstaje, temu Pan Bóg daje- Whoever gets up in the morning, God gives him

Kto budzi się o poranku ma więcej czasu- Who wakes up in the morning has more time

Możemy o poranku zrobić plan dnia- We can make a plan for the day in the morning

Możemy o poranku ćwiczyć- We can exercise in the morning

Czy lubisz poranki?- Do you like mornings?

Planować swój dzień- Plan your day

Ludzie pracowici osiągają sukces- Hardworking people achieve success

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Dyscypliny sportowe - Sports disciplines.

=====

Thanks to my Sponsors for Helping Support me:

If you or know some body you know is struggling with anxiety and want to know how to be 100% anxiety free, in 6 weeks, without therapy or drugs, fully guaranteed - then let me tell you about our sponsor Daniel Packard.

Daniel Packard is a U.C. Berkeley Mechanical Engineer and his research company spent 8 years researching and testing to develop an innovative process that solves your anxiety permanently in just 6 weeks - with an astounding 90% success rate. And because their program is so effective, people who join their program only pay at the end, once they have clear, measurable results.

If you’re interested in solving your anxiety in 6 weeks - fully guaranteed - and you want to learn more and have a free consultation with Daniel, go to https://www.danielpackard.com/


Do you have High Blood Pressure and/ or want to get off the Meds

Doctors are amazed at what the Zona Plus can do

$50 Discount with my Code ROY https://www.zona.com/discount/ROY

—-----------------------------

Quality Polish manufacturer of Metal Products for Telecommunication + workshop equipment and other metal articles.

Brochure https://bit.ly/ROY-partnercode . Let us know if you would like a quotation shipped internationally and very competitive rates


Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Dyscypliny sportowe - Sports disciplines

Kolarstwo- Cycling

Rower górski- Mountain bike

Wspinaczka- Climbing

Gimnastyka- Gymnastics

Kajakarstwo- Canoeing

Jeździectwo- Horse riding

Żeglarstwo- Sailing

Szermierka- Fencing

Lekkoatletyka- Athletics

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Ankieta - Questionnaire.

=====

Thanks to my Sponsors for Helping Support me:

If you or know some body you know is struggling with anxiety and want to know how to be 100% anxiety free, in 6 weeks, without therapy or drugs, fully guaranteed - then let me tell you about our sponsor Daniel Packard.

Daniel Packard is a U.C. Berkeley Mechanical Engineer and his research company spent 8 years researching and testing to develop an innovative process that solves your anxiety permanently in just 6 weeks - with an astounding 90% success rate. And because their program is so effective, people who join their program only pay at the end, once they have clear, measurable results.

If you’re interested in solving your anxiety in 6 weeks - fully guaranteed - and you want to learn more and have a free consultation with Daniel, go to https://www.danielpackard.com/


Do you have High Blood Pressure and/ or want to get off the Meds

Doctors are amazed at what the Zona Plus can do

$50 Discount with my Code ROY https://www.zona.com/discount/ROY

—-----------------------------

Quality Polish manufacturer of Metal Products for Telecommunication + workshop equipment and other metal articles.

Brochure https://bit.ly/ROY-partnercode . Let us know if you would like a quotation shipped internationally and very competitive rates


Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Ankieta - Questionnaire

Poznajmy się- Let's get to know each other

Kim jesteś?- Who are you from?

Narodowość- Nationality

Jestem Polakiem, Polką- I'm Polish

Jestem Irlandką, Irlandczykiem- I'm Irish

Kim jesteś z zawodu?- What's your occupation?

Ja jestem nauczycielką- I'm a teacher

Czym się interesujesz?- What you're interested in?

Interesuję się literaturą, sportem, biznesem- I'm interested in literature, sports, business

Czego nie lubisz?- What don't you like?

Nie lubię kawy i ryżu- I don't like coffee and rice

Nie lubię nosić swetra, wolę koszulę- I don't like wearing a sweater, I prefer a shirt

Jaki sport lubisz?- What sport do you like?

Lubię koszykówkę- I like basketball

O czym marzysz?- What are you dreaming about?

Moim marzeniem jest jechać do wszystkich krajów- My dream is to go to all countries

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Wymienić nasze ubrania na jesienne ubrania - Replace our clothes with autumn clothes

.

=====

Thanks to my Sponsors for Helping Support me:

If you or know some body you know is struggling with anxiety and want to know how to be 100% anxiety free, in 6 weeks, without therapy or drugs, fully guaranteed - then let me tell you about our sponsor Daniel Packard.

Daniel Packard is a U.C. Berkeley Mechanical Engineer and his research company spent 8 years researching and testing to develop an innovative process that solves your anxiety permanently in just 6 weeks - with an astounding 90% success rate. And because their program is so effective, people who join their program only pay at the end, once they have clear, measurable results.

If you’re interested in solving your anxiety in 6 weeks - fully guaranteed - and you want to learn more and have a free consultation with Daniel, go to https://www.danielpackard.com/


Do you have High Blood Pressure and/ or want to get off the Meds

Doctors are amazed at what the Zona Plus can do

$50 Discount with my Code ROY https://www.zona.com/discount/ROY

—-----------------------------

Quality Polish manufacturer of Metal Products for Telecommunication + workshop equipment and other metal articles.

Brochure https://bit.ly/ROY-partnercode . Let us know if you would like a quotation shipped internationally and very competitive rates


Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Szafa- Wardrobe

Wymienić nasze ubrania na jesienne ubrania- Replace our clothes with autumn clothes

Płaszcz- Coat

Jesienią często pada deszcz- It often rains in autumn

Kolorowe parasole- Colorful umbrellas

Mokre skarpetki- Wet socks

Kalosze- Rain boots

Kurtka przeciwdeszczowa- Rain jacket

Sweter- Sweater

Jesienią wieje wiatr- In autumn the wind blows

Szalik- Scarf

Buty za kostkę- Ankle boots

Rajstopy- Tights

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Idiomy - Idioms.

=====

Thanks to my Sponsors for Helping Support me:

If you or know some body you know is struggling with anxiety and want to know how to be 100% anxiety free, in 6 weeks, without therapy or drugs, fully guaranteed - then let me tell you about our sponsor Daniel Packard.

Daniel Packard is a U.C. Berkeley Mechanical Engineer and his research company spent 8 years researching and testing to develop an innovative process that solves your anxiety permanently in just 6 weeks - with an astounding 90% success rate. And because their program is so effective, people who join their program only pay at the end, once they have clear, measurable results.

If you’re interested in solving your anxiety in 6 weeks - fully guaranteed - and you want to learn more and have a free consultation with Daniel, go to https://www.danielpackard.com/


Do you have High Blood Pressure and/ or want to get off the Meds

Doctors are amazed at what the Zona Plus can do

$50 Discount with my Code ROY https://www.zona.com/discount/ROY

—-----------------------------

Quality Polish manufacturer of Metal Products for Telecommunication + workshop equipment and other metal articles.

Brochure https://bit.ly/ROY-partnercode . Let us know if you would like a quotation shipped internationally and very competitive rates


Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Idiomy - Idioms

Głowa - Head

Groch - Pea

Kapusta - Cabbage

Mieć w głowie groch z kapustą - Have peas and cabbage in mind (hotch – potch)

Mieć w głowie chaos, bałagan - To have a mess in your mind

Miałem w głowie groch z kapustą kiedy robiłem dużo projektów - I had peas and cabbage in mind when I was doing a lot of projects

Kiedy czujesz, że masz w głowie groch z kapustą medytujesz - When you feel like you have peas and cabbage in your head, you meditate

Kiedy widzę całą listę zadań mam w głowie groch z kapustą - When I see the whole list of tasks I have a peas and cabbage in my mind

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Jesienią dni są krótsze niż teraz - In autumn the days are shorter than now.

=====

Thanks to my Sponsors for Helping Support me:

If you or know some body you know is struggling with anxiety and want to know how to be 100% anxiety free, in 6 weeks, without therapy or drugs, fully guaranteed - then let me tell you about our sponsor Daniel Packard.

Daniel Packard is a U.C. Berkeley Mechanical Engineer and his research company spent 8 years researching and testing to develop an innovative process that solves your anxiety permanently in just 6 weeks - with an astounding 90% success rate. And because their program is so effective, people who join their program only pay at the end, once they have clear, measurable results.

If you’re interested in solving your anxiety in 6 weeks - fully guaranteed - and you want to learn more and have a free consultation with Daniel, go to https://www.danielpackard.com/


Do you have High Blood Pressure and/ or want to get off the Meds

Doctors are amazed at what the Zona Plus can do

$50 Discount with my Code ROY https://www.zona.com/discount/ROY

—-----------------------------

Quality Polish manufacturer of Metal Products for Telecommunication + workshop equipment and other metal articles.

Brochure https://bit.ly/ROY-partnercode . Let us know if you would like a quotation shipped internationally and very competitive rates


Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Jesień – Autumn

Żółte liście w lesie - Yellow leaves in the forest

Oznaki jesieni - Signs of Autumn

Dużo deszczu - Lots of rain

Jesienią jest zimno i wietrznie - It's cold and windy in autumn

Jesienią dni są krótsze niż teraz - In autumn the days are shorter than now

Babie lato - Indian summer

Pajęczyna, pająk - Spider's web, spider

Kurtka - Jacket

Ciepła czapka - Warm hat

Kalosze - Rain boots

Parasol - Umbrella

Ulewa - Heavy rain

Mżawka - Drizzle

Dynia – Pumpkin

Zupa dyniowa - Pumpkin soup

Ciasto dyniowe - Pumpkin cake

Gorąca herbata - Hot tea

Grzane wino, piwo (grzaniec) - Mulled wine, beer

Zbierać grzyby - Pick mushrooms

Zupa grzybowa - Mushroom soup

Sos grzybowy - Mushroom sauce

Gruszka - Pear

Śliwka – Plum

Weki - Preserves

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

To nie to samo - This is not the same.

=====

Thanks to my Sponsors for Helping Support me:

If you or know some body you know is struggling with anxiety and want to know how to be 100% anxiety free, in 6 weeks, without therapy or drugs, fully guaranteed - then let me tell you about our sponsor Daniel Packard.

Daniel Packard is a U.C. Berkeley Mechanical Engineer and his research company spent 8 years researching and testing to develop an innovative process that solves your anxiety permanently in just 6 weeks - with an astounding 90% success rate. And because their program is so effective, people who join their program only pay at the end, once they have clear, measurable results.

If you’re interested in solving your anxiety in 6 weeks - fully guaranteed - and you want to learn more and have a free consultation with Daniel, go to https://www.danielpackard.com/


Do you have High Blood Pressure and/ or want to get off the Meds

Doctors are amazed at what the Zona Plus can do

$50 Discount with my Code ROY https://www.zona.com/discount/ROY

—-----------------------------

Quality Polish manufacturer of Metal Products for Telecommunication + workshop equipment and other metal articles.

Brochure https://bit.ly/ROY-partnercode . Let us know if you would like a quotation shipped internationally and very competitive rates


Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Quiz – Quiz

To nie to samo - This is not the same

Wyjdziesz po mnie? - Will you go out for me?

Wyjdziesz za mnie? - Will you marry me?

Idę po kawę - I'm going to take a coffee

Idę na kawę - I'm going for a coffee

Idę do sklepu po kawę - I'm going to the shop for a coffee

Idę do restauracji na kawę - I'm going to a restaurant for coffee

Czekam na pociąg - I'm waiting for a train

Czekam na pociągu - I'm waiting on the train

Tomek wypił dużo piwa - Tom drank a lot of beer

Tomek wypił duże piwo - Tom drank a large beer

Może to jego pasja - Maybe it's his passion

Morze to jego pasja - The sea is his passion

Ona uczy polskiego - She teaches Polish

Ona uczy się polskiego - She is learning Polish

Pytam o cenę - I'm asking for the price

Pytam o ocenę - I'm asking for an assessment

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Co robimy gdy mamy mało energii? - What do we do when we're low on energy?

=====

Thanks to my Sponsors for Helping Support me:

If you or know some body you know is struggling with anxiety and want to know how to be 100% anxiety free, in 6 weeks, without therapy or drugs, fully guaranteed - then let me tell you about our sponsor Daniel Packard.

Daniel Packard is a U.C. Berkeley Mechanical Engineer and his research company spent 8 years researching and testing to develop an innovative process that solves your anxiety permanently in just 6 weeks - with an astounding 90% success rate. And because their program is so effective, people who join their program only pay at the end, once they have clear, measurable results.

If you’re interested in solving your anxiety in 6 weeks - fully guaranteed - and you want to learn more and have a free consultation with Daniel, go to https://www.danielpackard.com/


Do you have High Blood Pressure and/ or want to get off the Meds

Doctors are amazed at what the Zona Plus can do

$50 Discount with my Code ROY https://www.zona.com/discount/ROY

—-----------------------------

Quality Polish manufacturer of Metal Products for Telecommunication + workshop equipment and other metal articles.

Brochure https://bit.ly/ROY-partnercode . Let us know if you would like a quotation shipped internationally and very competitive rates


Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Pogoda zmienia się - The weather is changing

Wrzesień – September

Zima, wiosna, lato, jesień - Winter, Spring, Summer, Autumn

Co robimy gdy mamy mało energii? - What do we do when we're low on energy?

Porada - Advice

Chodzić na spacer - To take a walk

Chodzić na siłownię - Go to the gym

Słuchać muzyki - Listen to the music

Wziąć zimny prysznic - Take a cold shower

Obejrzeć ciekawy film - Watch an interesting movie

Filmy dokumentalne - Documentaries

Komedie – Comedies

Medytacja - Meditation

Jeździć na rowerze - Ride a bicycle

Spotkać się z przyjaciółmi - Meet with friends

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Pierwszy dzień szkoły - 1st Day of School.

=====

Thanks to my Sponsors for Helping Support me:

If you or know some body you know is struggling with anxiety and want to know how to be 100% anxiety free, in 6 weeks, without therapy or drugs, fully guaranteed - then let me tell you about our sponsor Daniel Packard.

Daniel Packard is a U.C. Berkeley Mechanical Engineer and his research company spent 8 years researching and testing to develop an innovative process that solves your anxiety permanently in just 6 weeks - with an astounding 90% success rate. And because their program is so effective, people who join their program only pay at the end, once they have clear, measurable results.

If you’re interested in solving your anxiety in 6 weeks - fully guaranteed - and you want to learn more and have a free consultation with Daniel, go to https://www.danielpackard.com/


Do you have High Blood Pressure and/ or want to get off the Meds

Doctors are amazed at what the Zona Plus can do

$50 Discount with my Code ROY https://www.zona.com/discount/ROY

—-----------------------------

Quality Polish manufacturer of Metal Products for Telecommunication + workshop equipment and other metal articles.

Brochure https://bit.ly/ROY-partnercode . Let us know if you would like a quotation shipped internationally and very competitive rates


Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Szkoła- School

Nauczyciel- Teacher

Tablica- Blackboard

Plecak- Backpack

Tornister- Satchel

Książki- Books

Lekcja- Lesson

Przerwa- Break

Czas na kanapkę- Time for a sandwich

Praca domowa- Homework

Dzieci idą do szkoły- Children go to school

Nauczyciel uczy- Teacher teaches

Dzieci się uczą- Children learn

Nauczyciel pisze nowe słowa na tablicy- The teacher writes new words on the blackboard

W plecaku jest kanapka, butelka wody- There's a sandwich and a bottle of water in the backpack

Długopis- Pen

Ołówek- Pencil

Podręcznik do historii - History textbook

Zeszyt ćwiczeń- Workbook

Język polski- Polish language

Matematyka- Mathematic

Historia – History

Wychowanie fizyczne- Physical education

Język angielski- English language

Etyka / religia- Ethics / Religion

Geografia- Geography

Chemia- Chemistry

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Na wsi- In the countryside

.

=====

Thanks to my Sponsors for Helping Support me:

If you or know some body you know is struggling with anxiety and want to know how to be 100% anxiety free, in 6 weeks, without therapy or drugs, fully guaranteed - then let me tell you about our sponsor Daniel Packard.

Daniel Packard is a U.C. Berkeley Mechanical Engineer and his research company spent 8 years researching and testing to develop an innovative process that solves your anxiety permanently in just 6 weeks - with an astounding 90% success rate. And because their program is so effective, people who join their program only pay at the end, once they have clear, measurable results.

If you’re interested in solving your anxiety in 6 weeks - fully guaranteed - and you want to learn more and have a free consultation with Daniel, go to https://www.danielpackard.com/


Do you have High Blood Pressure and/ or want to get off the Meds

Doctors are amazed at what the Zona Plus can do

$50 Discount with my Code ROY https://www.zona.com/discount/ROY

—-----------------------------

Quality Polish manufacturer of Metal Products for Telecommunication + workshop equipment and other metal articles.

Brochure https://bit.ly/ROY-partnercode . Let us know if you would like a quotation shipped internationally and very competitive rates


Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Na wsi- In the countryside

Traktor- Tractor

Rolnik prowadzi traktor-The farmer drives the tractor

Rolnik pracuje na polu- The farmer works in the field

Na polu rośnie zboże- Wheat grows in the field

Chleb robimy ze zboża- We make bread from wheat

Strach na wróble- Scarecrow

Kura daje jajka- The hen gives eggs

Krowa daje mleko- Cow gives milk

Świnia- Pig

Owce- Sheep

Owoce- Fruits

Królik- Rabbit

Koń- Horse

Sucha trawa- Dry grass

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Lista zadań do zrobienia - To do list.

=====

Thanks to my Sponsors for Helping Support me:

If you or know some body you know is struggling with anxiety and want to know how to be 100% anxiety free, in 6 weeks, without therapy or drugs, fully guaranteed - then let me tell you about our sponsor Daniel Packard.

Daniel Packard is a U.C. Berkeley Mechanical Engineer and his research company spent 8 years researching and testing to develop an innovative process that solves your anxiety permanently in just 6 weeks - with an astounding 90% success rate. And because their program is so effective, people who join their program only pay at the end, once they have clear, measurable results.

If you’re interested in solving your anxiety in 6 weeks - fully guaranteed - and you want to learn more and have a free consultation with Daniel, go to https://www.danielpackard.com/


Do you have High Blood Pressure and/ or want to get off the Meds

Doctors are amazed at what the Zona Plus can do

$50 Discount with my Code ROY https://www.zona.com/discount/ROY

—-----------------------------

Quality Polish manufacturer of Metal Products for Telecommunication + workshop equipment and other metal articles.

Brochure https://bit.ly/ROY-partnercode . Let us know if you would like a quotation shipped internationally and very competitive rates


Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Co dzisiaj muszę zrobić? -What do I have to do today?

Lista zadań do zrobienia - To do list

Planować dzień- To plan a day

Dzisiaj muszę zrobić zakupy- I have to shop today

Ja robię zakupy w poniedziałek- I shop on Monday

Posprzątać dom- Clean the house

Dzisiaj muszę iść na pocztę wysłać list-I have to go to the post office today to send a letter

Zapłacić za rachunki-Pay Bills

Odebrać dziecko z przedszkola / ze szkoły- Pick up the child from kindergarten / school

Zadzwonić do mamy- Call mom

Dzisiaj muszę wydrukować dokumenty- I have to print the documents today

Ugotować jedzenie- Cook food

Dzisiaj muszę edytować kilka podcastów- I have to edit some podcasts today

Muszę wymienić zdjęcie- I must replace the photo

Muszę ugotować jedzenie- I must cook food

Muszę odpoczywać- I need to rest

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Jechać / Jeździć - To go / To ride.

=====

Thanks to my Sponsors for Helping Support me:

If you or know some body you know is struggling with anxiety and want to know how to be 100% anxiety free, in 6 weeks, without therapy or drugs, fully guaranteed - then let me tell you about our sponsor Daniel Packard.

Daniel Packard is a U.C. Berkeley Mechanical Engineer and his research company spent 8 years researching and testing to develop an innovative process that solves your anxiety permanently in just 6 weeks - with an astounding 90% success rate. And because their program is so effective, people who join their program only pay at the end, once they have clear, measurable results.

If you’re interested in solving your anxiety in 6 weeks - fully guaranteed - and you want to learn more and have a free consultation with Daniel, go to https://www.danielpackard.com/


Do you have High Blood Pressure and/ or want to get off the Meds

Doctors are amazed at what the Zona Plus can do

$50 Discount with my Code ROY https://www.zona.com/discount/ROY

—-----------------------------

Quality Polish manufacturer of Metal Products for Telecommunication + workshop equipment and other metal articles.

Brochure https://bit.ly/ROY-partnercode . Let us know if you would like a quotation shipped internationally and very competitive rates


Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Jechać - To go

Jeździć - To ride

Jechać jeden raz - To go one time

Dzisiaj, jutro jadę - Today, tomorrow I'm going

Jeździć regularnie każdego dnia - Ride regularly every day

Jeździć często, zwykle- Ride often, usually

Dzisiaj jadę do sklepu, zawsze jeżdżę do sklepu

  • Today I'm going to the store, I always go to the store

Jutro jadę do sklepu - I'm going to the store tomorrow

Teraz jadę - Now i'm going

Zwykle jeżdżę - I usually go

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Odpady - Waste.

=====

Thanks to my Sponsors for Helping Support me:

If you or know some body you know is struggling with anxiety and want to know how to be 100% anxiety free, in 6 weeks, without therapy or drugs, fully guaranteed - then let me tell you about our sponsor Daniel Packard.

Daniel Packard is a U.C. Berkeley Mechanical Engineer and his research company spent 8 years researching and testing to develop an innovative process that solves your anxiety permanently in just 6 weeks - with an astounding 90% success rate. And because their program is so effective, people who join their program only pay at the end, once they have clear, measurable results.

If you’re interested in solving your anxiety in 6 weeks - fully guaranteed - and you want to learn more and have a free consultation with Daniel, go to https://www.danielpackard.com/


Do you have High Blood Pressure and/ or want to get off the Meds

Doctors are amazed at what the Zona Plus can do

$50 Discount with my Code ROY https://www.zona.com/discount/ROY

—-----------------------------

Quality Polish manufacturer of Metal Products for Telecommunication + workshop equipment and other metal articles.

Brochure https://bit.ly/ROY-partnercode . Let us know if you would like a quotation shipped internationally and very competitive rates


Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Odpady - Waste

Śmieci – Garbage

Kosz na śmieci - Trash bin

Segregować śmieci - Segregate garbage

Wyrzucać śmieci - Throw out the trash

Śmieciarka - Garbage truck

Śmieciarz - Garbage man

Śmietnik - Dumpster

Wysypisko śmieci - Garbage dump

Dzikie wysypisko śmieci - Wild garbage dump

Akcja sprzątanie świata - Cleaning up the world action

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

City Offices - Urzędy Miejskie.

Please consider donating so I may continue to create free content https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Urząd skarbowy - Tax Office

Zakład Ubezpieczeń Społecznych (ZUS)- Social Insurance Institution

Wydział Paszportowy- Passport Department

Wydział Spraw Cudzoziemców- Department of Foreigners

Wydział Komunikacji- Communications Department

Urząd Pocztowy (poczta)- Post Office

Państwowa Straż Pożarna- State fire brigade

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Budynki w mieście - Buildings in the city

.

Please consider donating so I may continue to create free content https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Budynki w mieście - Buildings in the city

Kamienica- Tenement

Blok mieszkalny- Block of flats

Urząd Miasta- City hall

Instytucja państwowa- State institution

Wieżowiec- Skyscraper

Centrum handlowe- Shopping mall

Katedra, kościół- Cathedral, church

Szpital- Hospital

Ambasada- Embassy

Konsulat- Consulate

Komisariat policji- Police station

Apartamentowiec- Apartment building

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Types of Fish - Rodzaje ryb.

Please consider donating so I may continue to create free content https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Smaczne ryby - Tasty fish

Smażalnia ryb- Fish Bar

Świeża ryba- Fresh fish

Mrożona ryba- Frozen fish

Rybak łowi ryby- Fisherman catches fish

Kuter rybacki- Fishing boat

Sieć- Net

Dorsz- Cod

Śledzie- Herring

Flądra- Flounder

Flądra z frytkami i surówką- Flounder with fries and salad

Turbot- Turbot

Ości- Bone

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Znaki drogowe - Road signs.

Please consider donating so I may continue to create free content https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Znaki drogowe - Road signs

Zakaz parkowania- No parking

Blokada na koła- Wheel lock

Mandat- Mandate

Zakaz wjazdu- No entry

Droga z pierwszeństwem- Priority road

Ustąp pierwszeństwa- Yield

Nakaz skrętu w lewo- Left turn order

Nakaz skrętu w prawo- Right turn order

Uwaga pieszy na drodze- Attention pedestrian on the road

Skrzyżowanie równorzędne- Equivalent intersection

Wypadek samochodowy- Car accident

Czarny punkt- Black point

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Burzowy dzień - Stormy day.

Please consider donating so I may continue to create free content https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Burzowy dzień - Stormy day

Latem są burze- There are thunderstorms in the summer

Objawy burzy- Storm symptoms

Upał, bardzo gorąco- Hot, very hot

Jest duszno, nie możemy oddychać- It's stuffy, we can't breathe

Burza- Storm

Błyskawica- Lightning

Parasol- Umbrella

Pada deszcz- It's raining

Leje (pada bardzo duży deszcz)- It's pouring down (it's raining very heavily)

Kalosze- Rain boots

Dzieci lubią skakać do kałuży- Children like jumping into puddles

Tęcza- Rainbow

Po burzy świeci słońce (idiom)- After the storm the sun shines (idiom)

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Spójniki - Conjunctions.

Please consider donating so I may continue to create free content https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Spójniki - Conjunctions

Albo, lub – Or

Wypiję kawę albo herbatę- I will drink coffee or tea

Pojadę w góry albo nad morze- I'll go to the mountains or to the sea

I, oraz – And

Lubię kawę i herbatę- I like coffee and tea

Lubię piwo i wino- I like beer and wine

Lubię owoce oraz warzywa- I like fruits and vegetables

Lubię słuchać muzyki oraz chodzić na koncerty- I like listening to music and going to concerts

Też, także, również – Also

Lubię też sok- I also like juice

Lubię także sok- I also like juice

Lubię również sok- I also like juice

Bo, ponieważ – Because

Lubię kawę, bo mam po niej więcej energii - I like coffee because it gives me more energy

Uczę się polskiego, ponieważ chcę pracować w Polsce- I am learning Polish because I want to work in Poland

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Gofry z + narzędnik- Waffles with + instrumental.

Please consider donating so I may continue to create free content https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Gofry- Waffles

Gofry z + narzędnik- Waffles with + instrumental

Gofry z bitą śmietaną- Waffles with whipped cream

Gofry z borówkami- Waffles with blueberries

Gofry z polewą czekoladową- Waffles with chocolate coating

Gofry z truskawkami- Waffles with strawberries

Gofry z cukrem pudrem- Waffles with powdered sugar

Gofry z lodami- Waffles with ice cream

Gofry z owocami- Waffles with fruit

Gofry z dżemem- Waffles with jam

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Idioms 3 - Idiomy 3.

Please consider donating so I may continue to create free content https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Idiomy- Idioms

Czuć do kogoś miętę- To be sweet on somebody

Mężczyzna jest atrakcyjny-The man is attractive

Portal randkowy- Dating site

Czują do siebie sympatię- They feel sympathy to each other

Adorować kogoś- Adore someone

Uwielbiać kogoś- Admire someone

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Wakacje nad morzem - Holidays at the seaside.

Please consider donating so I may continue to create free content https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Wakacje nad morzem- Holidays at the seaside

Morze- Sea

Pokoje do wynajęcia- Rooms for rent

Spacerować po plaży- Walk on the beach

Pływać statkiem- Cruising by boat

Morze Bałtyckie, Bałtyk- Baltic Sea, Baltic

Bursztyny- Amber

Naszyjnik z bursztynów- Amber necklace

Spacery promenadą- Promenade walks

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Wakacje w górach - Holidays in the mountains.

Please consider donating so I may continue to create free content https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Wakacje w górach- Holidays in the mountains

Góry- Mountains

Pensjonat- Guesthouse

Schronisko górskie- Mountain shelter

Wędrować - Roam

Piesze wędrówki- Hiking

Dobre, wygodne buty górskie- Good, comfortable mountain shoes

Wspinać się, wspinaczka górska- Climb, mountaineering

Zdobywać szczyty- Reach the top

Przejażdżka kolejką linową- Cableway ride

Wycieczki rowerowe- Bike tours

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Wakacje w mieście - Holidays in the city.

Please consider donating so I may continue to create free content https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Wakacje w mieście - Holidays in the city

Miasto- City

Zwiedzać nowe miasta- Explore new cities

Zabytki i pomniki- Sights and monuments

Architektura- Architecture

Stare miasto- Old Town

Stary rynek- Old Market Square

Koncerty na świeżym powietrzu- Outdoor Concerts

Posiłki w restauracji- Restaurant meals

Zwiedzanie muzeum - Visiting a museum

Owocne spędzanie czasu- Spending time productively

Spacery po mieście- City walks

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Wakacje nad jeziorem - Holidays by the lake.

Please consider donating so I may continue to create free content https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Wakacje nad jeziorem - Holidays by the lake

Jezioro – Lake

Namiot - Tent

Pole namiotowe - Campsite

Czy lubisz spać pod namiotem? - Do you like sleeping in a tent?

Nie jest to drogi nocleg - It's not an expensive place

Śpiwór - Sleeping bag

Uprawiać sporty wodne - Do water sports

Żeglować - Sail

Żaglówka - Sailboat

Skuter wodny - Jet ski

Mazury - Masuria

Możemy wypożyczyć rower wodny - Can we rent a pedal boat

Komary - Mosquitos

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Chcę mi się pić - I want to drink.

Please consider donating so I may continue to create free content https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Pić- Drink

Picie- Drinking

Chcę mi się pić- I want to drink

Szklanka- Glass

Szklanka wody, mleka, herbaty, soku- Glass of water, milk, tea, juice

Napoje- Drinks

Butelka wody- Bottle of water

Woda mineralna gazowana, niegazowana- Sparkling and still mineral water

Woda gazowana z cytryną- Sparkling water with lemon

Zimne piwo- Cold beer

Sok wyciskany- Squeezed juice

Wyciskarka do soku- Juicer juice

Kieliszek szampana, wódki, wina- A glass of champagne, vodka, wine

Łyk- Sip

Daj mi łyka wody- Give me a sip of water

Filiżanka- Cup

Napoje bezalkoholowe, alkoholowe- Soft drinks, alcoholic drinks

Słomka- Straw

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Agroturystyka - Agritourism.

Please consider donating so I may continue to create free content https://www.podpage.com/learn-polish-podcast/support/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Wieś- Countryside

Agroturystyka- Agritourism

Kontakt z naturą- Contact with nature

Dom na wsi- House in the countryside

Rzeka- River

Możemy pływać w rzecze- We can swim in the river

Pływać kajakiem- Canoeing

Możemy łowić ryby- We can fish

Pole- Field

Łąka- Meadow

Rolnik- Farmer

Zwierzęta- Animals

Kura, kurczak, kogut, krowa, królik, koń, świnia, owca- Hen, Chicken, Rooster, Cow, Rabbit, Horse, Pig, Sheep

Na wsi jest cisza i spokój- There is peace and quiet in the countryside

Na wsi jest nudno- It's boring in the countryside

Patrzeć na ptaki- Look at the birds

Drzewo- Tree

Drzewa owocowe- Fruit trees

Sad- Orchard

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Narzędzia - Tools.

Please consider donating so I may continue to create free content https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Złota rączka - Handyman

Złota rączka umie wszystko zreperować- The handyman can fix everything

Specjalista- Specialist

Dwie lewe ręce- Two left hands

Narzędzia- Tools

Młotek- Hammer

Wkrętarka- Drill-driver

Śrubki- Screws

Gwoździe- Nails

Śrubokręt- Screwdriver

Kombinerki- Pliers

Nożyczki- Scissors

Drabina- Ladder

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Wakacje - Holidays.

Please consider donating so I may continue to create free content https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Wakacje- Holidays

Synonimy- Synonyms

Urlop (dla osób pracujących)- Leave (for working people)

Wypoczynek- Rest

Przerwa- Break

Wakacje to przerwa od pracy- Holidays are a break from work

Czas wolny- Free time

Wykorzystać czas dla siebie- Take time for yourself

Relaks- Relax

Odprężenie- Relaxation

Wczasy- Holiday

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Jest upał – It is very hot.

Please consider donating so I may continue to create free content https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Ciepło- Warm

Jest gorąco – It is hot

Jest upał – It is very hot

Jest skwar- It is very hot

Co robisz kiedy jest skwar?- What do you do when it is very hot?

Piję dużo wody – I drink a lot of water

Jest ukrop- It is very hot

W Irlandii rzadko jest ukrop- In Ireland it is rarely very hot

Basen w ogrodzie- Pool in the garden

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Sezonowe warzywa i owoce - Seasonal vegetables and fruits.

Please consider donating so I may continue to create free content https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Początek lata- Beginning of summer

Najdłuższy dzień, najkrótsza noc- The longest day, the shortest night

Co jeść latem?- What to eat in summer?

Sezonowe warzywa i owoce- Seasonal vegetables and fruits

Truskawki- Strawberries

Maliny- Raspberries

Ile kosztuje kilogram truskawek?- How much does a kilo of strawberries cost?

Czereśnie- Cherries

Zielone, białe szparagi- Green, white asparagus

Bób- Broad bean

Zielony groszek- Green peas

Ziemniaki- Potatoes

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Idiomy - Idioms.

Please consider donating so I may continue to create free content https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Idiomy – Idioms

Bułka z masłem - Piece of cake

Coś jest dla nas łatwe do zrobienia - Something is easy for us to do

Nic trudnego - Nothing hard

Podcasty to bułka z masłem - Podcasts are a piece of cake

Piąte koło u wozu - Fifth wheel on the cart

Coś jest niepotrzebne, nieużywane - Something is unnecessary, unused

Rower jest jak piąte koło u wozu - A bicycle is like a fifth wheel on a cart

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Symbole matematyczne - Math symbols.

Please consider donating so I may continue to create free content https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Matematyka – Math

Symbole matematyczne - Math symbols

Dodawanie - Addition

Odejmowanie – Subtraction

Mnożenie – Multiplication

Dzielenie – Division

Równa się - Is equal to

Nie równa się - Doesn't equal

Większe - Greater than

Mniejsze - Less than

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Brushes in Polish.

Please consider donating so I may continue to create free content https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Szczoteczka do mycia zębów- Toothbrush

Myjemy zęby szczoteczką do zębów- We brush our teeth with a toothbrush

Szczotka do czesania włosów- Hair brush

Używasz szczotki do czesania włosów?- Do you use a brush to comb your hair?

Szczotka do zamiatania podłogi- Floor sweeping brush

Często zamiatam podłogę- I often sweep the floor

Szczotka toaletowa- Toilet brush

Szczoteczka do mycia naczyń- Dishwashing brush

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Lato - Summer.

Please consider donating so I may continue to create free content https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Lato- Summer

Latem mam urodziny- My birthday is in the summer

Jest słonecznie- It's sunny

Świeci słońce- The sun shines

Jest ciepło- It's warm

Jest gorąco- It's hot

Opalam się- I sunbath

Lubię czytać książki w ogrodzie na leżaku na słońcu- I like to read books in the garden on a lawn chair in the sun

Mam leżak- I have a lawn chair

Mam okulary przeciwsłoneczne- I have sunglasses

Zmarszczki- Wrinkles

Musimy chronić skórę przed słońcem- We must protect our skin from the sun

Olejek do opalania- Tanning oil

Mam balsam do opalania- I have suntan lotion

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Przystanek autobusowy, tramwajowy - Bus, tram stop.

Please consider donating so I may continue to create free content https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Przystanek autobusowy, tramwajowy- Bus, tram stop

Czekamy na autobus / tramwaj- We are waiting for the bus/tram

Przepraszam, który autobus jedzie do centrum? - Excuse me, which bus goes to the center?

Przepraszam, który tramwaj jedzie na dworzec? - Excuse me, which tram goes to the station?

Przepraszam, czy ten tramwaj jedzie do centrum?- Excuse me, does this tram go to the center?

Przepraszam, czy ten autobus zatrzymuje się na ulicy Piotrkowskiej?- Excuse me, does this bus stop at Piotrkowska Street?

Przepraszam, czy mogę kupić bilet u motorniczego?- Excuse me, can I buy a ticket from the driver?

Czy jest tu blisko automat z biletami?- Is there a ticket machine nearby?

Przepraszam, gdzie mogę kupić bilet?- Excuse me, where can I buy a ticket?

Przepraszam, ile kosztuje bilet normalny / ulgowy?- Excuse me, how much is a normal/reduced ticket?

Przepraszam, czy muszę kupić bilet na bagaż / rower / wózek dziecięcy ?- Excuse me, do I need to buy a ticket for luggage / bicycle / baby stroller?

Przepraszam, czy mogę się z tym biletem przesiadać?- Excuse me, can I change with this ticket?

Przepraszam, czy muszę się przesiąść?- Excuse me, do I have to change?

Bilet miesięczny (migawka) - Monthly ticket

Przepraszam, czy to jest przystanek na żądanie?- Excuse me, is this a request stop?

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

In Memory of my Father Eamonn Coughlan who passed on 18th May 2023

Learn Polish in a fun way with short Episodes. On this episode we talk about

a sad topic Pogrzeb - Funeral.

Please consider donating so I may continue to create free content https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Śmierć- Death

Mój tata miał atak serce i nie żyje- My dad had a heart attack and he's dead

Kto się rodzi musi umrzeć- Who is born must die

On / Ona nie żyje- He/She is dead

On umarł, ona umarła- He died, she died

Kiedy umarł twój tata?- When did your dad die?

Mój tata umarł dwa tygodnie temu- My dad died two weeks ago

Pogrzeb- Funeral

Msza w kaplicy- Mass in the chapel

Trumna- Coffin

Kondolencje- Condolences

Wyrazy współczucia- Condolences

Ostatnie pożegnanie- Last good bye

Cmentarz-Cemetery

Kremacja- Cremation

Popiół- Ash

Urna- Urn

Zapalić znicz- Light a candle

Kwiaty- Flowers

Niech spoczywa w pokoju- Rest in peace

Pomoc innej osoby jest bardzo ważna- The help of another person is very important

Nigdy nie wiesz kiedy umrzesz- You never know when you'll die

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Dzień matki - Mother's Day.

Please consider donating so I may continue to create free content https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Dzień matki- Mother's Day

26 maja - 26th of May

Najlepsza mama – The best mom

Jak ma imię Twoja mama?- What's your mom's name?

Moja mama ma na imię Marzena- My mother's name is Marzena

Ile lat ma Twoja mama?- How old is Your Mom?

Moja mama ma 73 lata- My mom is 73 years old

Jej ulubione kwiaty to tulipany, czerwone róże- Her favorite flowers are tulips, red roses

Jej ulubiony kolor to fioletowy, czarny- Her favorite color is purple, black

Lubię gdy moja mama codziennie do mnie dzwoni- I like it when my mom calls me every day

Maminsynek- Mother's boy

Moja mama robi najlepszy obiad na Boże Narodzenie- My mom makes the best Christmas dinner

Indyk z ziemniakami - Turkey with potatoes

Moja mama zawsze powtarza kocham Cię, zadzwoń do mnie- My mom always says I love you, call me

Moje najlepsze wspomnienie z mamą- My best memory with my mom

Grałem z moją mamą w gry planszowe- I used to play board games with my mom

Miałyśmy z mamą czas żeby spacerować- Mom and I had time to walk

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Rzeczownik odczasownikowy - Verbs.

Please consider donating so I may continue to create free content https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Rzeczownik odczasownikowy- Gerund

Czytać – To read

Czytanie- Reading

Pisać- To write

Pisanie- Writing

Gotować- To cook

Gotowanie- Cooking

Słuchać- To listen

Słuchanie- Listening

Sprzątać- To clean

Sprzątanie- Cleaning

Pływać- To swim

Pływanie- Swimming

Spać- To sleep

Spanie- Sleeping

Mam problem z czytaniem po polsku- I have trouble reading Polish

Mam problem z gotowaniem- I have trouble cooking

Mam problem ze słuchaniem głośno muzyki- I have trouble listening to music loud

Czytanie książki zajmuje mi dwie godziny- It takes me two hours to read a book

Pisanie maili zajmuje mi trzydzieści minut- It takes me thirty minutes to write e-mails

Sprzątanie domu zajmuje mi cały dzień- It takes me all day to clean the house

Nagrywanie podcastów zajmuje mi cały dzień – It takes me all day to record podcasts

Pisanie grafiku zajmuje mi dziesięć minut- It takes me ten minutes to write a schedule

Pływanie zajmuje mi jedną minutę- It takes me one minute to swim

Moje obowiązki w pracy: wysyłanie maili, dzwonienie do klienta- My duties at work: sending e-mails, calling the client

Moje obowiązki w domu: sprzątanie, gotowanie - My duties at home: cleaning, cooking

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

The Difference between Miasto - City & Miejsce- Place.

Please consider donating so I may continue to create free content https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Miasto – City

W tym mieście jest dużo turystów- There are a lot of tourists in this city

Co jest w mieście?- What's in the city?

W mieście jest basen - There is a swimming pool in the city

Lubię zwiedzać nowe miasta- I like exploring new cities

Łódź i Warszawa to piękne miasta- Lodz and Warsaw are beautiful cities

To miasto jest piękne, klimatyczne, stare- This city is beautiful, atmospheric, old

Miejsce- Place

W tym miejscu jest punkt zbiórki- Here is the collection point

Lubię zwiedzać nowe miejsca- I like visiting new places

Park to piękne miejsce- The park is a beautiful place

Las to piękne miejsce- The forest is a beautiful place

Które miasto jest najpiękniejsze?- Which city is the most beautiful?

Kraków to najpiękniejsze miasto - Krakow is the most beautiful city

Stary rynek to najpiękniejsze miejsce w Krakowie- The Old Market Square is the most beautiful place in Krakow

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Biżuteria - Jewelry.

Please consider donating so I may continue to create free content https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Biżuteria- Jewelry

Biżuteria srebrna, złota, sztuczna- Silver, gold, imitation jewelry

Kolczyki- Earrings

Dziurka w uchu- Ear hole

Obrączka ślubna- Wedding ring

Pierścionek- Ring

Pierścionek zaręczynowy- Engagement ring

Naszyjnik- Necklace

Korale- Corals

Perły- Pearls

Bransoletka- Bracelet

Sklep jubilerski - Jewelry store

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Please consider donating so I may continue to create free content https://www.podpage.com/learn-polish-podcast/support/

Learn Polish in a fun way with short Episodes. On this episode we talk about

Domowe ciasteczka - Homemade Cookies.

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Słodycze- Sweets

Ciasto- Cake

Ciasteczka- Cookies

Nie piekę- I don't bake

Domowe ciasteczka - Homemade Cookies

Blacha, forma do pieczenia- Baking form

Piekarnik- Oven

Dobra temperatura - Good temperature

Robot kuchenny- Food processor

Mikser- Mixer

Wyrabiać ciasto- Knead dough

Przygotować wszystkie składniki- Prepare all ingredients

Mąka, jajka, cukier, masło- Flour, eggs, sugar, butter

Foremki do ciasta- Cake molds

Wałek do ciasta- Rolling pin

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Please consider donating so I may continue to create free content https://www.podpage.com/learn-polish-podcast/support/

Learn Polish in a fun way with short Episodes. On this episode we talk about

Polskie przysłowia - Polish proverbs.

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Polskie przysłowia - Polish proverbs

Prawdziwych przyjaciół poznajemy w biedzie - We meet true friends in poverty

Dobry przyjaciel zawsze o nas pamięta - A good friend always remembers us

Kiedy przychodzi trudny czas zostaje jeden prawdziwy przyjaciel - When hard times come, one true friend stays

Mam kilka prawdziwych przyjaciół - I have some true friends

Kiedy masz problem nie możesz liczyć na pomóc - When you have a problem you can't count on help

Ludzie, którzy zawsze są przy nas - People who are always with us

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Co robimy w ogrodzie?- What we do in the garden?.

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Co robimy w ogrodzie?- What we do in the garden?

Możemy kosić trawę- We can mow the grass

Kosiarka elektryczna- Electric mower

Kosiarka na benzynę- Petrol lawnmower

Możemy podlewać kwiaty- We can water the flowers

Drzewka owocowe - Fruit trees

Sadzić drzewa- Plant trees

Kret kopie - Mole kicks

Posiać trawę- Sow grass

Wycinać, wyrywać chwasty- Cut, pull weeds

Przycinać drzewa- Pruning trees

Hodować warzywa- Grow vegetables

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Rozpalić Grilla- Light up the Grill.

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Kiedy jest ładna pogoda możemy robić grilla - When the weather is nice we can have a barbecue

W parku, w ogrodzie, w lesie- In the park, in the garden, in the forest

Grilla możemy robić na balkonie (grill elektryczny, gazowy)- We can make a barbecue on the balcony (electric, gas grill)

Węgiel do grilla- BBQ Charcoal

Podpałka do grilla- BBQ kindling

Rozpalić grilla- Light up the grill

Zapałki, zapalniczka- Matches, lighter

Rozżarzony węgiel- Burning coal

Możemy grillować kiełbasę, mięso, kurczaka, kaszankę- We can grill sausage, meat, chicken, black pudding

Grillować warzywa- Grill vegetables

Upiec ziemniaki na grillu- Bake potatoes on the grill

Przyprawy- Spices

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Długi majowy weekend (majówka) - Long May weekend (May weekend).

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Długi majowy weekend (majówka) - Long May weekend (May weekend)

Trzy dni wolne od pracy- Three days off

Święto Pracy (01.05) - Labor Day (01.05)

Dzień Flagi Rzeczypospolitej Polskiej (02.05) - Flag Day of the Republic of Poland (02.05)

Flaga polski jest biało-czerwona- The Polish flag is white and red

Święto Konstytucji Trzeciego Maja (03.05)- May 3rd Constitution Day (03.05)

Polacy często wyjeżdżają w góry, nad morze- Poles often go to the mountains, to the sea

Polacy robią grilla- Poles make a barbecue

Jadę z rodziną nad morze- I'm going to the seaside with my family

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Owoce morza – Seafood.

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Egzotyczne jedzenie - Exotic food

Owoce morza – Seafood

Jakie znasz owoce morza? - What seafood do you know?

Krewetki – Shrimp

Smażone ryby - Fried fish

Ośmiornica – Octopus

Kalmar – Squid

Krab – Crab

Małż - Mollusc

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Co jest w kuchni? - What's in the kitchen?.

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Co jest w kuchni? - What's in the kitchen?

W garnku gotujemy ziemniaki, zupę - We boil potatoes, soup in a pot

Jaka jest Twoja ulubiona zupa? - What's your favorite soup?

Rosół - Chicken soup

Zupa pomidorowa - Tomato soup

Zupa ogórkowa - Cucumber soup

Żurek - Sour soup

Barszcz czerwony - Red borscht

Czajnik – Kettle

W czajniku gotujemy wodę - We boil water in the kettle

Patelnia - Frying pan

Na patelni możemy zrobić jajecznicę, omlet, kotlety - In the frying pan we can make scrambled eggs, omelette, cutlets

Z kranu leci woda - Water flows from the tap

Nóż do warzyw, mięsa, chleba - Knife for vegetables, meat, bread

Deska do krojenia - Cutting board

Ile posiłków dziennie jesz? - How many meals a day do you eat?

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Zatrudnić, zatrudniać - Hire, employ.

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Co się dzieje w pracy? - What's going on at work?

Zatrudnić, zatrudniać - Hire, employ

Dać pracę - Give a job

Szukamy pracy - We're looking for a job

Rekrutować do pracy - Recruit for work

Szef zatrudnił mnie po rozmowie kwalifikacyjnej - The boss hired me after an interview

Teraz mam pracę, nie jestem bezrobotna - Now I have a job, I'm not unemployed

Ta firma przyjęła mnie do pracy - This company hired me to work

Zarabiać pieniądze - Earn money

Zwalniać, zwolnić z pracy - Fire from job

Szef zwolnił mnie i teraz nie mam pracy - My boss fired me and now I have no job

Jestem bezrobotna - I am unemployed

Nie mam pieniędzy - I have no money

Praca powinna dawać satysfakcję - Work should be satisfying

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Reklama - Advertisement.

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Reklama- Advertisement

Czy Ty lubisz reklamy?- Do you like ads?

Reklamy nie mówią prawdy- Advertisements don't tell the truth

Fałszywy obraz świata- A false picture of the world

Reklama radiowa- Radio advertisement

Reklama telewizyjna- TV advertisement

Reklama prasowa- Press advertisement

Reklama internetowa- Internet advertising

Obraz- Picture

Piękni ludzi, piękne samochody- Beautiful people, beautiful cars

Ludzie byli manipulowani- People were manipulated

Nie lubisz reklam- You don't like ads

Zmieniać kanał- Change channel

Reklamy są irytujące- Ads are annoying

Biznes prasowy upadnie- The press business will fail

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Instrukcje klasy szkoleniowej - Training Class Instructions.

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Instrukcje klasy szkoleniowej - Training Class Instructions

Siłownia- Gym

Polecenia- Commands

Weź wdech- Take a breath

Weź wydech- Exhale

Oddychaj głęboko- Breathe deeply

Wstań- Get up

Połóż się na plecach- Lie on your back

Połóż się na brzuchu- Lie on your belly

Połóż się na boku- Lie on your side

Ćwicz- Practice (train)

Rób brzuszki- Do crunches

Napnij brzuch- Tighten your belly

Rozluźnij brzuch- Relax your belly

Podnieś ciężarki- Lift weights

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Wielkanoc - Easter.

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Wielkanoc- Easter

Wielka noc – Huge night

Symbole Wielkanocy- Easter symbols

Jajka- Eggs

Pisanki (kolorowe jajka) – Painted (Easter) eggs (colorful eggs)

Zając czekoladowy- Chocolate bunny

Żurek - Sour soup

Babka wielkanocna- Easter cupcake

Czy lubisz piec ciasta?- Do you like to bake cakes?

Żonkil- Daffodil

Kolor żółty jest optymistyczny- Yellow is optimistic

Koszyk wielkanocny (święconka) - Easter basket

Wesołych świąt – Happy Easter

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Na czym można jeździć wiosną i latem? - What can you ride in spring and summer?.

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Na czym można jeździć wiosną i latem?- What can you ride in spring and summer?

Jeżdżę na deskorolce- I'm riding a skateboard

On lubi jeździć na rowerze i hulajnodze-He likes to ride a bike and scooter

Dużo ludzi jeździ na rolkach- Lots of people rollerblading

Czy lubisz jeździć na rolkach?- Do you like rollerblading?

Widziałeś wypadek, nogi rozjechały się- You saw the accident, the legs parted

Czy lubisz jeździć na hulajnodze?- Do you like riding scooter?

Hulajnoga tradycyjna, elektryczna- Traditional, electric scooter

Dużo ludzi jeździ na rowerze- Lots of people ride a bike

Jazda na rowerze jest ekologiczna- Cycling is eco-friendly

Nie jeżdżę na rowerze- I don't ride a bike

Drogi rowerowe- Bike roads

Kupiłem skuter- I bought a scooter

Chodzić pieszo- Walk

Gdzie chodzisz pieszo?- Where do you walk?

Chodzę po parku- I walk in the park

Planuję jeździć na rolkach- I plan to rollerblade

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Transport wodny - Water transport.

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Transport wodny - Water transport

Czym pływamy? - What do we swim with?

Pływam statkiem - To go by ship

Możemy pływać statkiem - We can go by ship

Kupić rejs statkiem - Buy a ship cruise

Oglądać zachód słońca - Watch the sunset

Pływać kajakiem – Canoeing

Piękne krajobrazy - Beautiful landscapes

Wodospad – Waterfall

Pływać łódką - To go by boat

Nad jeziorem możemy wypożyczyć rower wodny - We can rent a water bike by the lake

Czy byłeś w Polsce nad jeziorem? - Have you been by the lake in Poland?

Pływać żaglówką - To sail

Mazury, region w Polsce - Masuria, a region in Poland

Możemy pływać promem - We can go by ferry

Na promie są różne atrakcje - There are various attractions on the ferry

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Transport powietrzny - Air Transport.

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Transport powietrzny -Air Transport

Ptak, osa lata -Bird, wasp flying

Latać samolotem - Fly a plane

Bać się latać samolotem - To be afraid to fly a plane

Lęk wysokości - Fear of heights

Możemy latać balonem - We can fly a balloon

Możemy latać helikopterem - We can fly a helicopter

Uczyłem się jak latać helikopterem - I was learning how to fly a helicopter

Często latałem samolotem - I flew by plane often

Osoba musi być odważna - A person must be brave

Możemy latać motolotnią - We can fly a hang glider

Paralotnia – Paraglider

Latać rakietą w kosmos - Fly a rocket into space

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Transport lądowy - Land transport.

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Transport lądowy -Land transport

Podróżować - To travel

Czym jeździmy? - What are we driving?

Jeździmy samochodem - We drive a car

Podróżować autobusem - Travel by bus

Musimy stać na przystanku - We have to stand at the stop

Jeździć tramwajem - Go by tram

Tramwaj często przyjeżdża - The tram comes often

Korek - Traffic jam

Autobus musi się zatrzymać - The bus must stop

Tramwaj zawsze ma pierwszeństwo - The tram always has priority

Najbardziej ekonomiczny środek transportu to rower - The most economical kind of transport is the bicycle

Droga rowerowa - Bicycle path

Pojechać pociągiem do innego miasta - Go by train to another city

Przejazd kolejowy - Level crossing

Jeździć taksówką - Go by a taxi

Najdrożej jeździć taksówką - The most expensive to go by a taxi

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Mam prośbę - I have a request.

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Mam prośbę - I have a request

Czy możesz mi pomóc? - Can you help me?

Czy możesz mi powiedzieć gdzie jest bank? - Can you tell me where is the bank?

Czy możesz mi powiedzieć która jest godzina? - Can you tell me what time it is?

Czy możesz mi powiedzieć gdzie pracujesz? - Can you tell me where you work?

Czy możesz otworzyć / zamknąć okno? - Can you open/close the window?

Czy możesz pożyczyć mi książkę? - Can you lend me a book?

Czy możesz pożyczyć mi pieniądze? - Can you lend me some money?

Czy możesz do mnie zadzwonić? - Can you call me?

Czy możesz do mnie przyjść? - Can you come to me?

Czy możesz powtórzyć? - Can you repeat?

Czy możesz kupić mi kawę, obiad? - Can you buy me coffee, dinner?

Czy możesz przyjechać po mnie na lotnisko? - Can you pick me up at the airport?

Czy możemy robić cztery podcasty? - Can we do four podcasts?

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

W marcu jest jak w garncu - In March it's like in a pot.

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Dwanaście miesięcy - Twelve months

Teraz jest marzec - Now it's March

W marcu pogoda jest szalona - In March the weather is crazy

W marcu jest jak w garncu - In March it's like in a pot

Pogoda w marcu cały czas się zmienia - The weather in March changes all the time

Dzisiaj w Łodzi pada śnieg - It's snowing in Lodz today

Wszystkie składniki mieszają się - All ingredients mix

Nie wiemy jaka pogoda będzie jutro -We don't know what the weather will be tomorrow

Ubrać się na cebulkę - Dress up like onion

Ludzie często chorują - People often get sick

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Dzień Kobiet - Women's Day.

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Dzień Kobiet - Women's Day

Ładna kobieta - Pretty Woman

Nie znam ładnej kobiety - I don't know a pretty woman

Widzę, lubię ładną kobietę - I see, I like a pretty woman

Przyglądam się ładnej kobiecie - I'm looking at a pretty woman

Rozmawiam z ładną kobietą - I'm talking to a pretty woman

Myślę o ładnej kobiecie - I'm thinking of a pretty woman

Witam Cię piękna kobieto - Hello pretty woman

Jak się masz piękna kobieto?- How are you pretty woman?

Życzmy wszystkiego najlepszego dla wszystkich kobiet - Let's wish all the best to all women

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Czasowniki rucha Wejsc i Wyjsc - Verbs moving in and out.

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Ubrania zimowe - Winter Clothes.

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Wiosna - Spring.

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Cztery pory roku- Four Seasons

Początek kalendarzowej wiosny- Beginning of calendar spring

Wiosną jest pięknie- Spring is beautiful

Wiosną świeci słońce- The sun shines in spring

Wiosną jest ciepło- It's warm in spring

Możemy założyć kolorowe, wiosenne ubrania- We can wear colorful spring clothes

Wiosną przyroda budzi się- Nature wakes up in spring

Ptaki śpiewają- Birds are singing

Kwiaty kwitną- Flowers bloom

Ogród jest kolorowy- The garden is colorful

Dzień jest dłuższy- The day is longer

Możemy robić grilla- We can do a barbeque

Możemy spacerować- We can walk

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Obiad - Lunch.

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Tłusty czwartek - Fat Thursday.

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Tłusty czwartek - Fat Thursday

Polacy jedzą pączki - Poles eat donuts

Pączek – Donut

Nie liczę kalorii - I don't count calories

Czy lubisz pączki? - Do you like donuts?

Pączki z dżemem, marmoladą, serem - Donuts with jam, marmalade, cheese

Pączki z czekoladą - Donuts with chocolate

Ile pączków zjadłeś? - How many donuts have you eaten?

Dziś nie liczę kalorii i zjadłam cztery pączki - Today I don't count calories and ate four donuts

Naleśnikowy wtorek - Pancake Tuesday

Naleśniki z cukrem i z cytryną - Pancakes with sugar and lemon

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Walentynki - Valentine's day.

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Walentynki - Valentine's day

Dzień zakochanych - Valentine's day

Kocham Cię - I love you

Uwielbiam Cię - I adore you

Szaleję za Tobą - I'm crazy for you

Ubóstwiam Cię - I adore you

Przepadam za Tobą - I like you very much

Wielbię Cię - I adore you

Darzę Cię miłością - I give you love

Czuję do Ciebie sympatię - I feel sympathy for you

Ludzie idą do restauracji, do kina - People go to the restaurant, to the cinema

Czekoladki w kształcie serduszka - Heart shaped chocolates

Kwiaty – Flowers

Czerwone róże - Red roses

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Co jesz na śniadanie - What do you eat for breakfast?

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Śniadanie – Breakfast

Po śniadaniu - After breakfast

Czy Ty jesz śniadanie? - Do you eat breakfast?

Na czczo - On an empty stomach

Owsianka z owocami - Oatmeal with fruit

Płatki śniadaniowe z mlekiem - Corn flakes with milk

Jajka sadzone - Fried eggs

Jajko na twardo - Boiled egg

Jajko na miękko - Soft-boiled egg

Jajecznica - Scrambled eggs

Naleśniki z dżemem, bananem - Pancakes with jam, banana

Kanapki z dżemem - Sandwiches with jam

Kanapki z szynką - Sandwiches with ham

Omlet z warzywami - Vegetable omelette

Jogurt waniliowy, truskawkowy - Vanilla, strawberry yogurt

Bułka z serem, szynką i sałatą - Roll with cheese, ham and lettuce

Śniadanie to najważniejszy posiłek - Breakfast is the most important meal

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Prezentacja Nieformalna - Informal Presentation.

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Czy lubisz weekendy? - Do you like weekends?

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Czy lubisz weekendy? - Do you like weekends?

Co lubisz robić w weekend? - What do you like to do on the weekend?

W weekend lubię długo spać - I like to sleep long on weekend

W weekend możemy iść na dyskotekę i tańczyć - On the weekend we can go to the disco and dance

W weekend ludzie chodzą do kina - People go to the cinema on weekends

W weekend ludzie lubią robić zakupy - On the weekend people like to shop

W weekend możemy nic nie robić - We can do nothing on the weekend

W weekend możemy spotkać się ze znajomymi, z rodziną - On the weekend we can meet with friends, with family

W weekend możemy dbać o relacje z innymi osobami - During the weekend we can take care of relationships with other people

W weekend możemy grać w gry - On the weekend we can play games

Gry planszowe- Board games

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about Powitania i Pożegnania - Greetings and Farewells.

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Powitanie -Welcome

Pożegnanie - Farewell

Dzień dobry - Good morning

Witam Pana - Welcome Sir

Witam Panią - Welcome Mrs

Witam Państwa - Welcome ladies and gentlemen

Witam serdecznie - Hello and welcome

Do widzenia Goodbye

Do zobaczenia - See you

Do usłyszenia - Hear you

Do następnego razu - Until next time

Jak się Pan / Pani ma? - How are you?

Co u Pana / Pani słychać? - How is going ?

Wszystko w porządku - Everything's all right

Nic nowego - Nothing new

Po staremu - The old way

Źle - Badly

Cześć - Hello

Siema - Hi

Hej - Hi

Nara - Bye

Pa - Bye

Do jutra - See you tomorrow


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Nagle Wypadek - Suddenly an Accident.

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Nagle Wypadek - Suddenly an Accident

Nagłe wypadki – Emergencies

Potrzebujemy pomocy - We need help

Ratunku – Help

Pali się – Fire

Ewakuacja – Evacuation

Złodziej – Thief

Przepraszam, może mi Pan / Pani pomóc? - Excuse me, can you help me?

Muszę zadzwonić - I have to call

Mam rozładowany telefon - I have a discharged phone

Czy mogę skorzystać z Pana / Pani telefonu? - Can I use your phone?

Zostałem okradziony - I was robbed

Zostałem napadnięty - I was attacked

Proszę wezwać policję, pogotowie, straż pożarną - Please call the police, ambulance, fire brigade

Proszę wezwać straż miejską - Please call the police

Graphic can be downloaded from here https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Kierunki na mapie - Map Directions.

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Kierunki na mapie - Map Directions

Graphics to Freely download at https://www.facebook.com/learnpolishpodcast


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Wynajmować mieszkanie - Rent an apartment.

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Wynajmować mieszkanie - Rent an apartment

Dzwonię w sprawie mieszkania - I'm calling about an apartment

Oferta wynajmu mieszkania w centrum miasta - Offer for renting an apartment in the city center

Ile mieszkanie ma metrów? - How many meters is the apartment?

To mieszkanie ma 45 metrów - This apartment is 45 meters

Na którym piętrze jest to mieszkanie? - What floor is this apartment on?

Na ósmym piętrze - On the eighth floor

Czy jest winda w budynku? - Is there an elevator in the building?

Czy mieszkanie jest umeblowane? - Is the apartment furnished?

Nowoczesne meble - Modern furniture

Czy mieszkanie jest po remoncie? - Is the apartment renovated?

Jaka jest cena tego mieszkania za miesiąc? - What is the price of this apartment per month?

Dwa tysiące plus opłaty - Two thousand plus fees

Czy cenę można negocjować? - Can the price be negotiated?

Dobra lokalizacja - Good localization

Jaki jest Twój budżet? - What is your budget?

Kiedy mogę zobaczyć to mieszkanie? - When can I see this apartment?

Jaka to jest ulica? - What street is it?

Jak mogę tam dojechać? - How can I get there?


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Dzień Babci i Dziadek - Grandmother's & Grandfather's day.

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Babcia - Grandma

Dziadek - Grandfather

Dzień Babci - Grandmother's day

Dzień Dziadka - Grandfather's day

To jest mój dziadek, moja babcia - This is my grandfather, my grandmother

Kocham mojego dziadka, moją babcię - I love my grandpa, my grandma

Dziękuję mojemu dziadkowi za pomoc - Thank you to my grandfather for help

Dziękuję mojej babci za pyszne ciasto - Thank you my grandma for the delicious cake

Bez mojego dziadka jest smutno - It's sad without my grandfather

Bez mojej babci jest bardzo pusto - It's very empty without my grandma

Moja babcia ma na imię Barbara - My grandmother's name is Barbara

Mój dziadek niestety nie żyje - Unfortunately my grandfather is dead

Ona miała 96 lat - She was 96 years old

Jaka była Twoja babcia? - What was your grandma like?

Babcia była bardzo sympatyczna, gotowała dla mnie lunch - Grandma was very nice, she cooked lunch for me

Moja babcia bardzo dobrze gotowała - My grandmother cooked very well

Nie znam dobrze dziadka - I don't know grandpa well

Moja babcia bardzo ładnie maluje i robi na drutach szalik - My grandma paints very well and knits a scarf

Mój dziadek bardzo lubił chodzić do lasu - My grandfather was very fond of going to the forest

Mój dziadek był myśliwym - My grandfather was a hunter


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Zarezerwować pokój w hotelu - Book a hotel room.

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Rezerwacja pokoju - Room reservation

Dużo osób podróżuje - A lot of people travel

Zarezerwować pokój w hotelu - Book a hotel room

Chciałbym zarezerwować pokój - I would like to book a room

Pokój jednoosobowy - Single room

Pokój dwuosobowy - Two-person room

Pokój trzyosobowy - A triple room

Pokój z łazienką - Room with bathroom

Pokój ze śniadaniem / bez śniadania - Room with breakfast / without breakfast

Co oferują na śniadanie? - What do they offer for breakfast?

Pokój z klimatyzacją - Room with air conditioning

Od kiedy chce Pan zarezerwować pokój? - Since when do you want to book a room?

Na jak długo? - For how long

Na trzy noce - For three nights

Chciałbym zarezerwować pokój dwuosobowy ze śniadaniem i klimatyzacją od dzisiaj na trzy dni - I would like to book a double room with breakfast and air conditioning from today for three days

O której godzinie muszę opuścić pokój? - What time do I have to leave the room?

Doba hotelowa - Hotel night

Miłego pobytu - Have a pleasant stay


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Czy Ty się stresujesz? - Are you stressed?

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Stres -Stress

Życie jest stresujące -Life is stressful

Praca jest stresująca - Work is stressful

Lubię robić to co kocham - I like doing what I love

Każdy z nas stresuje się - We all get stressed

Czy Ty się stresujesz? - Are you stressed?

Kiedy jestem zestresowany lubię medytować - When I'm stressed I like to meditate

Kiedy jestem zestresowany idę na siłownię - When I'm stressed I go to the gym

Możemy słuchać muzyki relaksacyjnej - We can listen to relaxing music

Nie myśleć o problemie - Don't think about the problem

Możemy spacerować - We can walk

Możemy obejrzeć lekki film - We can watch a light movie

Możemy spać - We can sleep

Można wpaść w depresję - You can get depressed

Możemy spotkać się z przyjaciółmi i porozmawiać - We can meet friends and talk

Dobry przyjaciel poprawi nam humor - A good friend will cheer us up

Czytanie książki - Book reading

Pić zioła - Drink herbs

Dobre, zdrowe jedzenie - Good, healthy food


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Co można robić w internecie - What can you do on the internet.

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Co można robić w internecie? - What can you do online?

Można pracować - You can work

Dzięki internetowi możemy studiować - Thanks to the Internet, we can study

Szukać informacji - Look for information

Umieć zadać pytanie - Be able to ask a question

Robić zakupy w internecie - Shop online

Możemy słuchać muzyki -We can listen to music

Oglądać filmy - Watch movies

Słuchać podcastów - Listen to podcasts

Grać w gry - Play games

Korzystać w mediów społecznościowych - Use on social media

Możemy poznawać nowych ludzi - We can meet new people

Szukać klientów - Look for customers

Płacić rachunki - Pay bills

Robić przelewy - Make transfers

Zaoszczędzić czas - Save time


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Lubię spać - I like to Sleep.

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Lubię spać - I like to Sleep


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Lubię siłownię - I Like the gym.

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Lubię siłownię - I Like the gym


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Moje plany na Nowy Rok - My plans for New Year.

Donations https://www.podpage.com/learn-polish-podcast/support/

Store https://www.podpage.com/learn-polish-podcast/store/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Moje plany na Nowy Rok - My plans for New Year


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Kalendarzowa zima - Calendar winter.

Donations https://www.podpage.com/learn-polish-podcast/support/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Kalendarzowa zima - Calendar winter

Czy lubisz zimę? - Do you like winter?

Morsowanie - Winter swimming

Zimą jest zimno i mroźno - Winter is cold and frosty

Skrobać szyby w samochodzie - Scrape car windows

Burza śnieżna - A snowstorm

Dzieci lubią kiedy pada śnieg - Children like it when it snows

Rzucać śnieżkami - Throw snowballs

Temperatura poniżej zera - Temperature below zero

Cztery pory roku - Four Seasons


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Sylwester - New Year's Eve.

Donations https://www.podpage.com/learn-polish-podcast/support/

Our Websites https://www.podpage.com/learn-polish-podcast/

https://learnpolish.podbean.com/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Sylwester - New Year's Eve

Impreza noworoczna - New Year Party

Jak lubisz spędzać sylwestra? - How do you like to spend New Year's Eve?

Chodziłem na dyskotekę - I went to the disco

Chodziłem do kolegi - I went to my friend

Wolę być w domu - I'd rather be home

Gdzie idziesz na sylwestra? - Where are you going on New Year's Eve?

Można zrobić coś dobrego do jedzenia - You can make something good to eat


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Boże Narodzenie - Christmas.

Donations https://www.awakeningpodcast.org/support/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Boże Narodzenie - Christmas

Symbole Bożego Narodzenia - Christmas symbols

Choinka - Christmas tree

Święty Mikołaj - Santa Claus

Grzeczne dzieci - Polite children

Jakie prezenty kupujesz? - What gifts do you buy?

Rodzina jest razem - The family is together

Czas miłości - Time of love

Świąteczne potrawy - Christmas dishes

Karp w galarecie - Carp in jelly

Pierogi z kapustą i grzybami - Dumplings with cabbage and mushrooms

Zupa grzybowa - Mushroom soup

Barszcz czerwony - Red borscht

Karp smażony - Fried carp

Sałatki - Salads

Ciasta - Cakes

Post - Fast

Lepić bałwana - Make a snowman

Święta rodzina - Holy Family

Pasterka - Midnight Mass

Śnieg - Snow


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Sporty zimowe - Winter sports.

Donations https://www.awakeningpodcast.org/support/

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Sporty zimowe -Winter sports

Sanki - Sled

Jeździć na sankach - Sledge

Snowboard -Snowboard

Jeździć na snowboardzie - Snowboarding

Łyżwy - Skates

Jeździć na łyżwach - Ice skating

Narty - Skis

Jeździć na nartach - Skiing

Buty do snowboardu - Snowboard boots

Czy lubisz jeździć na snowboardzie? - Do you like snowboarding?


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Dworzec kolejowy - Railway station.

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Pociąg - Train

Dworzec kolejowy - Railway station

Czy to jest pociąg do Warszawy? - Is this a train to Warsaw?

Szukam konduktora - I'm looking for a conductor

Konduktor sprzedaje i sprawdza bilety - The conductor sells and checks tickets

Dokąd jedzie ten pociąg? - Where is this train going?

Z którego peronu odjeżdża pociąg? - Which platform does the train leave from?

Czy możemy zamienić się miejscami? - Can we switch places?

Czy to miejsce jest wolne? - Is this seat free?

Czy mogę tu usiąść? - Can i sit here?

Przepraszam, czy mogę otworzyć / zamknąć okno? - Excuse me, can I open/close the window?

O której będziemy w Krakowie? - What time will we be in Cracow?

Przesiadka - Change

Jaka jest następna stacja? - What's the next station?

Pociąg kończy bieg - The train finishes road

Pociąg się spóźnia - The train is late


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Rodzina - Family.

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Rodzeństwo - Siblings

Rodzice - Parents

Rodzina - Family

Mam jednego brata - I have one brother

Świąteczny rodzinny klimat - Christmas family atmosphere

Mój brat mieszka w Holandii - My brother lives in Holland

Pamiętać o rodzeństwie - Remembering siblings

Kuzynka (siostra cioteczna) - Cousin

Mam dwoje rodziców - I have two parents

Mam dużą rodzinę - I have a big family

Drzewo genealogiczne - Family tree

Rodzinny czas - Family time


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Kuchnia - Kitchen.

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Kuchnia - Kitchen

Czajnik elektryczny - Electric kettle

Mikrofalówka - Microwave

Podgrzać jedzenie - Heat food

Robot kuchenny - Food processor

Ciasto domowej roboty - Homemade cake

Lodówka - Fridge

W lodówce trzymamy jedzenie - We keep food in the fridge

Zamrażalnik - Freezer

Zmywać naczynia - Wash the dishes

Zlewozmywak (zlew) - Kitchen sink

Zmywarka - Dishwasher

Kuchenka gazowa - Gas stove

Płyta indukcyjna - Induction hob

Piekarnik - Oven

Mikser - Mixer

Toster - Toaster


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Mistrzostwa świata w piłce nożnej - World football championship.

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Piłka nożna - Football

Mistrzostwa świata w piłce nożnej -World football championship

Oglądać mecz - Watch the match

Mecz piłki nożnej - Football match

Wygrać - Win

Przegrać - Lose

Gol - Goal

Piłkarz - Footballer

Biegać po boisku - Run around the football pitch

Bramka - Goal

Bramkarz stoi na bramce i broni - The goalkeeper stands in the goal and defends

Atakować - Attack

Strzelać gola - Score a goal

Czerwona / żółta kartka - Red/Yellow card

Sędzia piłkarski - Football referee

Remisować - Draw

Dogrywka - Overtime

Kibice - Fans

Dopingować - Cheer

Obrońca - Defender

Rzut karny - Penalty kick

Rzut wolny - Free kick

Drużyna piłkarska - Football team


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Co jest w łazience? - What's in the bathroom?

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Co jest w łazience? - What's in the bathroom?

W łazience jest wanna - There is a bathtub in the bathroom

Czy Ty lubisz się kąpać? - Do you like to take a bath?

Toaleta - Toilet

Robić siku - Pee

Robić kupę - Do poop

Prysznic - Shower

Pralka - Washing machine

Prać ubrania - To wash clothes

Szczoteczka i pasta do zębów - Toothbrush and toothpaste

Umywalka - Sink

Lustro - Mirror

Mydło - Soap

Ręcznik - Towel


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Przeprowadzać się - To move out.

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Przeprowadzka - Move

Przeprowadzać się - To move out

Nie lubię przeprowadzać się - I don't like moving

Pakować rzeczy, ubrania do pudełek - To pack things, clothes into boxes

Dobra organizacja - Good organization

W przyszłym tygodniu przeprowadzam się do innego miasta - Next week I'm moving to another city

Siedem razy przeprowadzałem się do nowego mieszkania - I moved to a new apartment seven times

Pozytywna zmiana - Positive change

Nowa okolica - New neighborhood

Początek nowego życia - The beginning of a new life

Rozpakować rzeczy - Unpack things


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Skąd wracasz? - Where are you coming back from?

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Skąd wracasz? - Where are you coming back from?

Wracam od kolegi - I'm coming back from my friend

Wracam od lekarza - I'm coming back from the doctor

Wracam od fryzjera - I'm coming back from the barber

Wracam z kina - I'm coming back from the cinema

Wracam ze szkoły - I'm coming back from school

Wracam z restauracji - I'm coming back from the restaurant

Wracam z filmu - I'm coming back from the movie

Wracam znad morza - I'm coming back from the sea

Wracam znad rzeki - I'm coming back from the river

Wracam z gór - I'm coming back from the mountains

Wracam z Tatr - I'm coming back from the Tatras


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

293 Mikołajki - Saint Nicholas' Day.

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Mikołajki - Saint nicholas' day

Dzieci dostają prezenty - Children get gifts

Jakie są najlepsze prezenty dla dzieci? - What are the best gifts for kids?

Miś, lalka - Teddy bear, doll

Drobne prezenty - Small gifts

Klocki lego - Lego bricks

Czas dla dzieci - Time for children

Gra planszowa - Board game

Kompromis - Compromise


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast #speakpolish

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Leniwy dzień - Lazy day.

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Leniwy dzień - Lazy day

Nudzi mi się - I'm bored

Nie mam co robić - have nothing to do

Nic mi się nie chce - I want to do nothing

Nie mam siły / energii - I have no strength / energy

Jestem zmęczony, zmęczona - I am tired, tired

Chce mi się spać - I'm sleepy

Nie mam ochoty - I do not want


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Święta rodzinne- Family holidays

.

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Święta rodzinne - Family holidays

Święta religijne - Religious holidays

Święta państwowe - Public holidays

Imieniny - Name day

Każdego dnia inna osoba ma imieniny - Every day a different person has a name day

Ludzie składają nam życzenia - People make us wishes

Urodziny - Birthday

Kiedy są Twoje urodziny? - When is your birthday?

Święto Niepodległości - Independence Day

Serdeczne życzenia z okazji imienin / urodzin - Best wishes on the name day / birthday

Wszystkiego najlepszego - Happy birthday

Zdrowia, szczęścia, miłości - Health, happiness, love

Spełnienia marzeń - Dreams come true

Jakie prezenty lubisz dostawać? - What kind of gifts do you like to receive?

Zabawki, gry, piłka - Toys, games, ball


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Dzień Niepodległości - Independence Day.

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Dzień Niepodległości - Independence Day

Święto państwowe - Public holiday

Polskie symbole narodowe - Polish national symbols

Polskie godło - Polish emblem

Biały orzeł - White Eagle

Flaga biało-czerwona -White and red flag

Hymn narodowy -National anthem

Świętować - Celebrate


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Apteka - Pharmacy.

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Apteka- Pharmacy

Jestem w aptece- I am at the pharmacy

Idę do apteki- I am going to pharmacy

Kupić lekarstwa- Buy medicine

Tabletki- Pills

Pigułki- Pills

Środki przeciwbólowe- Painkillers

Suplementy- Supplements

Recepta- Prescription

Aptekarz- Pharmacist

Chciałbym kupić coś na przeziębienie- I would like to buy something for a cold

Czy ma Pani receptę od lekarza- Do you have a prescription from a doctor?

Czy może mi Pan polecić dobre leki?- Can you recommend some good medications for me?

Jakie ma Pani objawy?- What are your symptoms?

Kaszlę i boli mnie gardło- I cough and have a sore throat

Pastylki do ssania- Lozenges

Życzymy Wam dużo zdrowia- We wish you good health


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Jestem na lotnisku - I'm on the airport.

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Kobieta jest na lotnisku - The woman is at the airport

Walizka - Suitcase

Jestem na lotnisku - I'm on the airport

Lubię latać samolotem - I like to fly by plane

Czekam na samolot - I'm waiting for the plane

Dokąd lecisz? - Where are you going?

Lecę do Irlandii - I'm going to Ireland

Odloty - Departures

Przyloty - Arrivals

O której godzinie przylatuje / odlatuje samolot? - What time does the plane arrive / depart?

Czy masz coś do oclenia? - Do you have anything to declare?

Mam karton papierosów - I have a carton of cigarettes

Proszę pokazać paszport / dowód osobisty - Please show your passport / ID card

Bagaż podręczny - Hand luggage

Lot jest odwołany - The flight is canceled

Lot jest opóźniony - The flight is delayed

Życzę miłego lotu - Have a nice flight


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Święto Zmarłych - All Saints' Day.

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Święto Zmarłych - All Saints' Day

Dzień wolny od pracy - Day off

Iść na cmentarz - Go to the cemetery

Kupować kwiaty - Buy flowers

Zapalić znicz - Light a candle

Pamiętać o zmarłych - Remember the dead

Odwiedzać groby zmarłych - Visit the graves of the dead

Położyć kwiaty na grobie - Put flowers on the grave

Modlić się - Pray

Dzieci chodzą od domu do domu i proszą o cukierki - Children go from house to house and ask for candy

Symbolem Halloween jest dynia - The symbol of Halloween is the pumpkin


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Czy Ty masz samochód? - Do you have a car?k.

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Czy Ty masz samochód? -Do you have a car?

Czy masz prawo jazdy? -Do you have a driving license?

Zdałem egzamin na prawo jazdy -I passed my driving test?

Czy lubisz prowadzić samochód? -Do you like driving a car?

Wolę prowadzić samochód niż jeździć tramwajem - I'd rather drive a car than ride a tram

Stacja benzynowa - Petrol station

Zatankować samochód - Refuel

Benzyna (paliwo) - Petrol (fuel)

Ropa- Oil

Mam samochód na gaz, ropę, benzynę - I have a car for gas, oil, petrol

Samochód elektryczny - Electric car

Umyć samochód - Wash the car

Myjnia samochodowa - Car wash

Raz w miesiącu myję samochód - I wash my car once a month

Warsztat samochodowy - Car repair shop

Naprawić auto- Fix auto

Wymienić części - Replace parts

Przegląd techniczny - Technical inspection

Mój przegląd techniczny kończy się w marcu - My technical inspection ends in March

Wymienić opony na letnie / zimowe - Replace tires with summer / winter

Złapać gumę - To have a flat tyre


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Prace domowe - Housework.

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Prace domowe - Housework

Sprzątanie - Cleaning

Prasowanie - Ironing

Gotowanie - Cooking

Odkurzanie - Vacuuming

Zmywanie naczyń - Washing dishes

Mycie podłogi - Cleaning the floor

Jakie prace domowe lubisz? - What kind of housework do you like?

Prasowanie jest bardzo relaksujące - Ironing is very relaxing

Ja lubię prasowanie, ale nie lubię odkurzania - I like ironing, but I don't like vacuuming

Pani sprząta mój dom - The lady cleans my house

Czy Ty robisz pranie? - Are you doing the laundry?

Płyn do płukania - Fabric softener

Proszek do prania - Detergent

Najlepsze jedzenie jest kiedy my sami gotujemy - The best food is when we cook ourselves

Gotować z miłością - Cook with love

Lubię prasowanie, gotowanie, pranie - I like ironing, cooking, washing

Kiedy jest dużo naczyń używam zmywarki - When there are a lot of dishes, I use the dishwasher

Zmywać w zlewie - To wash in the sink

Kamila ze szczotką - Kamila with a brush 


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Czasownik pójść - Verb: to go.

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Czasownik pójść - Verb: to go

Ja pójdę - I will go

Ty pójdziesz - You will go

On pójdzie - He will go

Ona pójdzie - She will go

Ono pójdzie - It will go

Pan pójdzie - You will go

My pójdziemy - We will go

Wy pójdziecie - You will go

Oni, one pójdą - They will go

Państwo pójdą - You will go

W weekend pójdę do kina, do parku - On the weekend I will go to the cinema, to the park

Dokąd pójdziesz w weekend? - Where will you go on the weekend?

Dokąd dzisiaj pójdziesz? - Where will you go today?

Dzisiaj pójdę do restauracji na śniadanie - Today I will go to the restaurant for breakfast

Dzisiaj pójdę na pocztę - Today I will go to the post office

Dokąd pójdziesz jutro? - Where will you go tomorrow?

Jutro pójdę do urzędu - Tomorrow I will go to the office

Jutro pójdę na zakupy - Tomorrow I will go shopping

Czy pójdziesz za mną do restauracji? - Will you go with me to the restaurant?

Czy pójdziesz ze mną do kina na film? - Will you go to the cinema with me for a movie?

Może pójdziemy razem do kina? - Maybe we will go to the cinema together?

Może pójdziemy na randkę? - Maybe we will go for a date?


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Rutyna - Routine.

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Rutyna - Routine

Zawsze - Always

Często - Often

Zwykle - Usually

Zazwyczaj - Usually

Czasami - Sometimes

Od czasu to czasu - From time to time

Rzadko - Rarely

Nigdy - Never

Co robisz zawsze? Zawsze myję zęby - What do you always do? - I always brush my teeth

Co robisz często? Często chodzę na siłownię - What do you do often? - I often go to the gym

Co robisz zwykle? Zwykle gotuję obiad - What do you usually do? - I usually cook dinner

Co robisz czasami? Czasami słucham muzyki - What do you do sometimes? - Sometimes I listen to music

Co robisz od czasu do czasu? Kupuję paliwo - What do you do from time to time? - I'm buying fuel

Co robisz rzadko? Rzadko stresuję się - What do you rarely do? - I rarely get stressed

Nigdy nie palę papierosów - I never smoke cigarettes

Jak często chodzisz do kina? - Rzadko - How often do you go to the cinema? - Rarely

Jak często oglądasz telewizję? - Czasami - How often do you watch TV? - Sometimes

Jak często uprawiasz sport? - Zwykle trzy, cztery razy w tygodniu- How often do you play sports? - Usually three or four times a week

Jak często jesz pizzę? - Dwa razy w tygodniu - How often do you eat pizza? - Twice a week


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Podróże - Travels.

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Podróże - Travels

Czy lubisz podróżować? - Do you like to travel?

Czym najbardziej lubisz podróżować? - What do you like to travel by the most?

Często jestem turystą - I am often a tourist

Podróżowałem do czterdziestu państw - I have traveled to forty countries

Lubię zwiedzać miasto - I like to visit the city

W mieście jest dużo interesujących obiektów - There are many interesting objects in the city

Piękna architektura - Beautiful architecture

Stare miasto - Old Town

Przepraszam, jak dojść do? - Sorry, how to you get to?

Jak dojść do zoo, do kościoła? - How to get to the zoo, to the church?

Przepraszam, jak dojechać do? - Excuse me, how do I get to?

Przepraszam, jak dojechać do zamku? - Excuse me, how do I get to the castle?

Przepraszam, gdzie jest dworzec kolejowy? - Excuse me, where is the train station?

Proszę iść prosto - Please go straight

Proszę skręcić w prawo, w lewo - Please turn right, left

Proszę jechać autobusem numer 8 - Please take bus number 8

Przepraszam, jak dojść do starego rynku? - Excuse me, how to get to the old market?

Proszę iść prosto, skręcić w lewo, rynek będzie po prawej stronie - Go straight, turn left, the market will be on the right

Dużo pomników - Lots of monuments


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Zamawianie pizzy - Ordering pizza.

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Zamawianie pizzy - Ordering pizza

Jaką pizzę lubisz? - What kind of pizza do you like?

Margarita jest z serem i sosem pomidorowym - Margarita is with cheese and tomato sauce

Pizza wegetariańska - Vegetarian pizza

Pizzeria - Pizzeria

Czy masz ochotę iść dzisiaj do pizzerii? - Would you like to go to the pizzeria today?

Kim jest pizzerman? - Who is pizzerman?

Osoba, która robi pizzę - The person who makes the pizza

Pizza może być mała, średnia, duża - Pizza can be small, medium, large

Kiedy jestem z moim synem zamawiam dużą pizzę - When I am with my son I order a large pizza

Dwa kawałki pizzy - Two pieces of pizza

Pizza ma osiem kawałków - The pizza has eight pieces

Chciałbym zamówić pizzę na wynos - I would like to order a takeaway pizza

Włosi nie używają sosów - Italians don't use sauces

To nie jest klasyczna pizza - This is not a classic pizza

W Polsce jemy pizzę z sosem pomidorowym lub czosnkowym - In Poland, we eat pizza with tomato or garlic sauce

Wolę pizzę bez sosów, z oliwą - I prefer pizza without sauces, with oil

Zamówić pizzę z dowozem - Order a pizza with delivery

Zamówić pizzę na miejscu - Order a pizza on site

Raz na miesiąc każdy może zamówić pizzę - Once a month, everyone can order a pizza


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Przeziębienie - Cold.

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Przeziębienie - Cold

Czy Ty jesteś teraz przeziębiony? - Are you having a cold now?

Jesienią jest niska temperatura, wieje wiatr - In autumn, the temperature is low, the wind blows

Symptomy przeziębienia - Cold symptoms

Mam katar - I have a cold

Mam gorączkę - I have a fever

Mam dreszcze - I got chills

Termometr - Thermometer

Boli mnie głowa - My head hurts

Nie mam siły - I have no strength

Naturalne metody na przeziębienie - Natural remedies for cold

Olej kokosowy, olejek z oregano - Coconut oil, oil of oregano

Dobrej jakości miód z kurkumą - Good quality turmeric honey

Witamina C, D - Vitamin C, D

Inhalacje - Inhalations

Chusteczka do nosa - Handkerchief

Chusteczka materiałowa - Cloth handkerchief

Musimy reagować jak zobaczymy pierwsze symptomy przeziębienia - We must react when we see the first symptoms of a cold

Nie jeść dużo cukru - Don't eat a lot of sugar

Każdego dnia zwiększajmy odporność - Every day let's increase immunity

Dbać o siebie - Take care of yourself

Miejcie ciepłe ubrania - Have warm clothes


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Komunikacja miejska - Public transport.

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/35/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Komunikacja miejska - Public transport

Możemy jeździć samochodem - We can drive a car

Mogę jeździć po mieście autobusem - I can drive around the city by bus

Numery autobusów - Bus numbers

Możemy jeździć tramwajem - We can ride the tram

Tramwaj numer 4 - Tram number 4

Dwa razy jechałem tramwajem - I took the tram twice

Rower miejski - City bike

Elektryczna hulajnoga - Electric scooter

Rower nie musi stać w korku - The bicycle does not have to be stuck in a traffic jam

Helikopter - Helicopter

Metro jest pod ziemią - The subway is underground

Musimy kupić bilet - We need to buy a ticket

Bilet ulgowy - Reduced ticket

Bilet normalny - Regular ticket

Bilet miesięczny w Łodzi to migawka - The monthly ticket in Łódź is migawka


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Dzień nauczyciela - Teacher Day.

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/34/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Dzień nauczyciela - Teacher Day

Mój ulubiony nauczyciel - My favorite teacher

Czy miałeś swojego ulubionego nauczyciela? - Did you have a favorite teacher?

Nauczanie początkowe - Primary learning

Nauczyciel powinien być cierpliwy, kreatywny, pomocny - The teacher should be patient, creative, helpful

Nauczyciel powinien być energiczny - The teacher should be energetic

Nauczyciel powinien nie dawać pracy domowej - The teacher should not give homework

Praca nauczyciela jest bardzo interesująca, satysfakcjonująca - The teacher's work is very interesting, satisfying

Praca nauczyciela jest ciekawa, trudna - The teacher's work is interesting, difficult

Życzenia dla nauczyciela - Wishes for the teacher

Wszystkiego najlepszego z okazji Dnia nauczyciela - Best wishes on teacher's day

Dużo satysfakcji z pracy, dużo cierpliwości - Lots of job satisfaction, lots of patience

Studenci są największą nagrodą dla nauczyciela - Students are the greatest reward for the teacher


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Tryb rozkazujący - Imperative.

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/34/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Tryb rozkazujący - Imperative

Proszę przeczytać - Please read

Proszę napisać - Please write

Proszę + bezokolicznik - Please + infinitive

Przeczytaj książkę - Read a book

Przeczytaj ten tekst - Read this text

Napisz do mnie e-mail - Write me an e-mail

Powiedz mi coś - Tell me something

Powiedz gdzie mieszkasz - Tell me where do you live

Powiedz gdzie byłeś - Tell me where have you been

Proszę obejrzeć ten film - Please watch this video

Obejrzyj ten film - Watch this video

Zrób mi kawę, obiad - Make me coffee, dinner

Zjedz śniadanie, kanapkę - Eat breakfast, sandwich

Idź na spacer, na siłownie - Go for a walk, to the gym

Przyjdź do mnie - Come to me

Zadzwoń do babci - Call grandma


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Porządki domowe - House cleaning.

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/34/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Porządki domowe - House cleaning

Organizować porządki domowe - Organize housekeeping

Pani sprzątaczka - Cleaner lady

Sprzątać dom - Clean the house

Alergia na kurz - Dust allergy

Myć okna - Clean windows

Myć podłogę - Wash the floor

Specjalny płyn do podłogi - Special floor liquid

Odkurzać dywany - Vacuum carpets

Odkurzacz - Vacuum cleaner

Wycierać kurze - Mop the dust

Wynosić śmieci - Take out the garbage

Robić pranie - Do laundry

Pralka - Washing machine

Prasować pogniecione ubranie - Iron wrinkled clothing

Żelazko - Iron

Układać ubrania w szafie - To put clothes in the wardrobe


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Często chodzisz do dentysty? - Do you often visit the dentist?

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/34/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Jeden ząb - One tooth

Dwa zęby - Two teeth

Często chodzisz do dentysty? - Do you often visit the dentist?

Często myjesz zęby? - Do you brush your teeth often?

Człowiek ma trzydzieści dwa zęby - A man has thirty-two teeth

Ząb mądrości - Wisdom tooth

Dzieci mają zęby mleczne - Children have milk teeth

Boli mnie ząb - My tooth hurts

Który ząb Pana boli? - Which tooth of hurts You?

Ząb numer jeden to jedynka - Tooth number one is one

Ząb numer dwa to dwójka - Tooth number two is two

Górna jedynka - Upper one

Dolna jedynka - Lower one

Dbać o zęby - Take care of your teeth

Szczotkować zęby - Brush teeth

Czyścić zęby nicią dentystyczną - Clean teeth with dental floss

Płukać jamę ustną - Rinse mouth

Pasta do zębów - Toothpaste

Boli mnie górna jedynka - I have a pain in the upper one

Ząb kieł - Tooth fang

Jak długo już Pana boli? - How long have you been in pain?

Czy Pan myje zęby regularnie? - Do you brush your teeth regularly?

Bać się dentysty - To be afraid of the dentist


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Czy jesteś przesądny? - Are you superstitious?.

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/34/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Przesądy - Superstitions

Czy jesteś przesądny? - Are you superstitious?

Jakie są popularne przesądy? - What are the popular superstitions?

Co przynosi pecha/szczęście? - What brings bad luck / good luck?

Kiedy czarny kot przejdzie nam drogę to będzie pech - When the black cat crosses our path, it will be bad luck

Piątek trzynastego - Friday the thirteenth

Potłuczone lustro to siedem lat nieszczęścia - A broken mirror is seven years of misfortune

Dwa lustra obok to drzwi do piekła - The two mirrors next to it are the hell's door

Nie otwieraj parasola w domu - Do not open the umbrella at home

Nie przechodź pod drabiną- Don't go under the ladder

Nie kłaść nowych butów na stole w domu - Don't put new shoes on the table at home

Czterolistna koniczyna przynosi szczęście - A four-leaf clover brings good luck

Podkowa przynosi szczęście - Horseshoe brings good luck

Pieniądze na ulicy przynoszą szczęście - Money in the street brings happiness

Trzymać kciuki - Keep our fingers crossed

Nie zapeszać - Do not jinx


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Salon fryzjerski - Hairdressing salon.

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/34/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Jesień - Autumn

23 września zaczyna się astronomiczna jesień - On September 23rd begins the astronomical autumn

Czy lubisz jesień? - Do you like autumn?

Cztery pory roku: jesień, zima, wiosna, lato - Four seasons: fall, winter, spring, summer

Dzieci zbierają kasztany - Children collect chestnuts

Jesienią często pada deszcz - It often rains in the autumn

Parasol - Umbrella

Kolorowe liście - Colorful leaves

Jesień to czas kiedy mamy więcej czasu na czytanie książek - Autumn is the time when we have more time to read books

Ciepły koc - Warm blanket

Za oknem jest zimno i ciemno - Outside the window it is cold and dark

Można zrobić różne rzeczy z dyni - You can make a variety of pumpkins


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Salon fryzjerski - Hairdressing salon.

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/34/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Fryzjer - Hairdresser

Salon fryzjerski - Hairdressing salon

Nożyczki - Scissors

Grzebień (szczotka) do czesania włosów - Comb (brush) for combing the hair

Umyć włosy - Wash hair

Odżywka do włosów - Hair conditioner

Szampon do włosów - Shampoo

Chcę obciąć włosy, ale nie za krótko - I want to cut my hair but not too short

Chciałabym zmienić kolor włosów - I would like to change my hair color

Umyję Pani włosy - I will wash your hair

Chcę mieć inną fryzurę - I want a different hairstyle

Czy mógłby Pan skrócić moje włosy i polecić mi nową fryzurę z grzywką? - Could you please shorten my hair and recommend a new haistyle with bangs?

Proszę zobaczyć ten katalog - Please see this catalog

Bardzo pasują mi refleksy - I really like reflections

Jak się Pani podoba? - How do you like it?

Wygląda świetnie, dobra robota - Looks great, good job


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Nowy rok szkolny - New school year.

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/34/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Nowy rok szkolny - New school year

We wrześniu dzieci wracają do szkoły - In September children go back to school

Koniec wakacji - End of summer

Lubiłeś chodzić do szkoły? - Did you like going to school?

Przedmioty szkolne - School subjects

Język polski, angielski, matematyka, historia - Polish, English, mathematics, history

Jaki był Twój ulubiony przedmiot szkolny? - What was your favorite school subject?

Lubiłem biologię, matematykę - I liked biology, math

Umysł humanistyczny - Humanistic mind

Umysł ścisły - Strict mind

Co jest w tornistrze? - What's in the schoolbag?

Książki, zeszyty, piórnik - Books, notebooks, pencil case

Co jest w piórniku? - What's in the pencil case?

Długopisy, kredki, ołówek, gumka, flamastry, drugie śniadanie - Pens, crayons, pencil, eraser, felt-tip pens, lunch

Ocena - Mark

Byłem dobrą uczennicą - I was a good student


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Jak wyglądał świat dawniej, a jak wygląda dziś? - What was the world like in the past and what does it look like today?.

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/34/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Jak wyglądał świat dawniej, a jak wygląda dziś? - What was the world like in the past and what does it look like today?

Co ludzie robili kiedyś, a co robią dziś? - What people used to do and what are they doing today?

Kiedyś ludzie podróżowali konno albo chodzili pieszo - In the past, people traveled on horseback or walked

Ludzie latają teraz samolotem albo jeżdżą samochodem - People now fly by plane or drive by car

Dawniej ludzie pisali listy albo pisali na maszynie do pisania - In the past, people wrote letters or wrote on a typewriter

Teraz komunikują się przez internet, telefon komórkowy - Now they communicate via the internet, mobile phone

Dawniej ludzi uczyli się języka francuskiego - In the past, people learned French

Teraz ludzie uczą się angielskiego, chińskiego - Now people learn English, Chinese

Ludzie byli zdrowsi, bo jedli zdrowe jedzenie - People were healthier because they ate healthy food

Teraz mamy więcej urządzeń technologicznych - Now we have more technological equipments

Dawniej ludzie nie mieli światła i wody, żyli spokojniej - In the past, people did not have light and water, they lived more peacefully


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Moje dzieciństwo - My childhood.

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/33/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Moje dzieciństwo- My childhood

Co robiłem kiedy byłem mały - What did I do when I was little

Graliśmy z kolegami w tenisa - We played tennis with my friends

Jedliśmy lody - We ate ice cream

Chodziliśmy do parku - We used to go to the park

Chodziliśmy do kina, bo mieliśmy bilety za darmo - We went to the movies because we had tickets for free

Co lubiłeś? - What did you like?

Lubiłem oglądać bajki - I liked watching cartoons

Lubiłem jeść owsiankę na śniadanie - I liked eating porridge for breakfast

Lubiłem spotykać się z moją babcią - I liked meeting with my grandmother

Jak spędzałeś czas jako nastolatek? - How did you spend your time as a teenager?

Grałem na gitarze - I was playing the guitar

Kiedy miałem 16 lat uprawiałem sztuki walki - When I was 16, I was practicing martial arts

Kiedy myślę o moim dzieciństwie mam miłe myśli - When I think about my childhood I have nice thoughts

Grałem w gry planszowe z moją mamą - I used to play board games with my mom

Chodziłem z tatą do kina - I used to go to the cinema with my dad

Kiedy miałam siedem lat chodziłam do szkoły podstawowej - When I was seven I went to primary school

Spędzałam dużo czasu na dworze - I spent a lot of time outside


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Końcówki czas przeszłego - Past tense endings

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/33/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Końcówki czas przeszłego- Past tense endings

Bezokolicznik- Infinitive

Każda osoba ma inną końcówkę- Each person has a different ending

Odcinamy końcówkę w bezokoliczniku- We cut off the ending from the infinitive

Dodajemy końcówkę dla osoby- We add an ending for the person

CZYTAĆ + ENDING (końcówka) = czytaŁAM

Czytać (czytałam, czytałaś, czytała, czytałyśmy, czytałyście ,czytały)- Read (I read, you read, she read, we read, you read, they read)

Pisać (pisałem, pisałeś, pisał, pisaliśmy, pisaliście, pisali)- To write (I wrote, you wrote, he wrote, we wrote, you wrote, they wrote)

Wczoraj byłem w kinie- I was in a cinema yesterday

Wczoraj kupiłem chleb- Yesterday I bought bread

Wczoraj oglądałem film- Yesterday I was watching a movie

Wczoraj robiłem podcast- Yesterday I was making a podcast

Wczoraj gotowałem, jadłem, spałem- Yesterday I cooked, ate, slept

Co robiłaś wczoraj?- What did you do yesterday?

Wczoraj pracowałam, jadłam, oglądałam, kłamałam- Yesterday I worked, ate, watched, lied


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Czas przyszły (czasownik BYĆ)- Future tense (verb TO BE).

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/33/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Czas przyszły (czasownik BYĆ)- Future tense (verb TO BE)

Każda osoba ma inną końcówkę- Each person has a different ending

Wczoraj byłam w sklepie, w pracy- Yesterday I was at the store, at work

Wczoraj byłem na basenie, na zakupach- Yesterday I was at the pool, shopping

Ty byłaś na urodzinach- You were at birthday

Dzisiaj byłam u rodziny- Today I was with my family

Gdzie byłaś?- Where were you?

Ty byłeś, gdzie byłeś?- You were, where were you?

Byłem cały czas w domu- I was home all the time

Gdzie ona była?- Where was she?

Ona była na cmentarzu?- She was at the cemetery?

Ona była w banku, w teatrze- She was in the bank, in the theater

On był w kinie, w operze- He was at the cinema, at the opera

Dziecko było w parku- The child was in the park

Moje dziecko było chore- My child was sick

Gdzie Ty i twój syn byliście na wakacjach?- Where were you and your son on vacation?

Byliśmy w Estonii, w Grecji- We were in Estonia, Greece

Gdzie byłyście?- Where have you been?

Byłyśmy w sklepie, na zakupach- We were in the store, shopping

Gdzie one były?- Where were they?

One były na dyskotece?- They were at the disco?

Gdzie była Twoja mama?- Where was your mom?

Ona była w teatrze- She was at the theater

Gdzie był Twój tata?- Where was your dad?

On był w kinie- He was in the cinema


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Zaprosić na rozmowę kwalifikacyjną - Invite for an interview.

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/33/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Rozmowa kwalifikacyjna - Interview

Zaprosić na rozmowę kwalifikacyjną - Invite for an interview

Stresujący, ważny moment - A stressful, important moment

Jak się Pan nazywa? - What is your name?

Jakie ma Pan wykształcenie? - What is your education?

Mam wykształcenie wyższe - I have higher education

Jakie ma Pan mocne strony? - What are your strengths?

Jestem dobrym liderem - I am a good leader

Umiem pracować pod presją czasu - I can work under time pressure

Jestem kreatywny, mam dużo pomysłów - I am creative, I have a lot of ideas

Jakie ma Pan słabe strony? - What are your weaknesses?

Jestem za bardzo pracowity - I'm too hardworking

Jakie ma Pan doświadczenie? - What is your experience?

Pracowałem już w dwóch firmach - I have already worked in two companies

Dlaczego chce Pan tutaj pracować? - Why do you want to work here?

Jakie są Pana oczekiwania - What are your expectations?

Chcę zarabiać 5000 PLN miesięcznie - I want to earn 5000 PLN per month

Dobre warunki pracy - Good working conditions

Zniżki i ubezpieczenie - Discounts and insurance

Umowa na pełny etat - Full-time contract


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

CV (Życiorys)- CV (Curriculum Vitae).

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/33/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

CV (Życiorys) - CV (Curriculum Vitae)

Kiedy chcemy znaleźć pracę piszemy CV - When we want to find a job, we write a CV

Dane osobowe (imię, nazwisko, adres zamieszkania, data urodzenia, adres mailowy, numer telefonu)- Personal data (name, surname, address, date of birth, e-mail address, telephone number)

Wykształcenie (podstawowe, średnie, wyższe) - Education (primary, secondary, higher)

Mam wykształcenie wyższe - I have higher education

Jakie studia ukończyliśmy - What studies have we completed

Doświadczenie zawodowe - Experience

Moje doświadczenie zawodowe to praca jako lektorka - My professional experience is working as a teacher

Biznesmen nie musi pisać CV - The businessman does not have to write a CV

Umiejętności (obsługa komputera, kurs prawa jazdy, jestem dobrym liderem) - Skills (computer skills, driving course, I am a good leader)

Języki obce - Foreign Languages

Angielski to język ojczysty - English is the mother tongue

Poziom języka obcego - Foreign language level

Zainteresowania (podróże, psychologia, turystyka) - Interests (travel, psychology, tourism)

Klauzula RODO - GDPR clause


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #polishpodcast #learnpolishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Mam kiepski nastrój- I'm in a bad mood.

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/33/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Mam kiepski nastrój - I'm in a bad mood

Coś się stało - Something happened

Jestem niezadowolona z pracy - I am dissatisfied with my work

Jestem nieszczęśliwa, wszystko idzie źle - I'm unhappy, everything is going wrong

Czuję się niespełniona - I feel unfulfilled

Daj mi spokój - Give me a break

Zostaw mnie w spokoju, dzisiaj mam kiepski nastrój - Leave me alone, today I'm in a bad mood

Czasami czujemy się bez energii - Sometimes we feel without energy

Nie może iść pływać - He can't go swimming

Mam wyzwania - I have challenges

Sprzęty elektroniczne - Electronic devices

Czy Ty zawsze jesteś uśmiechnięty? - Are you always smiling?

Czy masz czasami kiepski nastrój? - Do you sometimes have a bad mood?

Kiepski nastrój masz bardzo rzadko - You rarely have a bad mood

Zrobić dla siebie coś co poprawi nastrój - Do something for yourself that will improve your mood


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #learnpolishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Sekret szczęśliwego życia - The secret of a happy life

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/33/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Dziękowanie - Thanks

Magiczne słowo: dziękuję za - The magic word: thank you for

Sekret szczęśliwego życia - The secret of a happy life

Czekamy na wielkie rzeczy w naszym życiu - We look forward to great things in our lives

Dziękowanie za małe rzeczy - Thanks for the little things

Skromny dom - Modest house

Dziękuję za dach nad głową - Thank you for the roof over your head

Dziękuję za jedzenie (że mamy co włożyć do garnka) - Thank you for the food (we have something to put in the pot)

Dziękuję za ciepłą wodę - Thank you for warm water

Dziękuję za prąd - Thank you for the electricity

Mam łóżko, prąd, ubranie, jedzenie, męża - I have a bed, electricity, clothes, food, a husband

Dziękujmy codziennie za wszystko - Let us thank you every day for everything


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #learnpolishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Wyrażanie zadowolenia - Expressing satisfaction

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/33/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Wyrażanie zadowolenia- Expressing satisfaction

Każda osoba chce być szczęśliwa w życiu- Every person wants to be happy in life

Jestem szczęśliwa / szczęśliwy- I am happy

Jestem zadowolona / zadowolony- I am satisfied / satisfied

Czuję się spełniona / spełniony- I feel fulfilled / fulfilled

Życie marzeń- Dream life

Domek na wsi- Cottage

Apartament w centrum miasta- Apartment in the city center

Duża rodzina z dziećmi- A big family with children

Bycie singlem- Being single

Robienie tego co się kocha- Doing what you love

Jak robić garnki?- How to make pots?

Każda osoba kocha robić co innego- Each person loves to do something else

Jakie jest Twoje życie marzeń?- What's your dream life?

Zawsze myślę o przyszłości- I always think about the future

Twoje życie marzeń to codzienne życie kiedy robisz to co lubisz- Your dream life is everyday life when you do what you like

Moje życie marzeń to życie na wsi w naturze i pomaganie ludziom- My dream life is living in the countryside in nature and helping people


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #learnpolishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Czy Ty lubisz chodzić na koncerty? - Do you like going to concerts?


Concerts Tickets Can be found at https://undercoverfestival.pl/en/homepage/


Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

=====================================

1st Episodes https://learnpolish.podbean.com/page/33/

=====================================

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Koncerty- Concerts

Czy Ty lubisz chodzić na koncerty?- Do you like going to concerts?

Chodziłem na koncerty w Estonii- I went to concerts in Estonia

Dziś wieczorem idę na koncert- Tonight I'm going to a concert

Jestem na koncercie- I'm at a concert

Koncert muzyki klasycznej- Classical music concert

Koncert muzyki rockowej- Rock music concert

Koncert muzyki jazzowej- Jazz music concert

Koncert muzyki techno- Techno music concert

Piosenkarzami są ludzie z całego świata- The singers are people from all over the world

Bilet jednodniowy kosztuje 69 PLN – A one-day ticket costs 69 PLN

Bilet dwudniowy - Two-day ticket

Będę na tym koncercie - I will be at this concert


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #learnpolishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Co jest na stole? - What's on the table?

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Co jest na stole?- What's on the table?

Talerz (na talerzu sałatka, tosty)- Plate (salad, toast on a plate)

Serwetki do wycierania twarzy- Face wiping napkins

Filiżanka, kubek do kawy- Cup, coffee mug

W kubku piję herbatę- I drink tea in a mug

Widelec- Fork

Łyżeczka do mieszania cukru- A spoon for mixing sugar

Łyżka do zupy- Soup spoon

Nóż- Knife

Szklanka wody- Glass of water

Kieliszek- Glass

Lampka wina- Glass of wine


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #learnpolishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Jak rozpocząć nowy dzień? - How to start a new day?.

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Jak rozpocząć nowy dzień?- How to start a new day?

Poranne rytuały- Morning rituals

Klucz do dobrego dnia- The key to a good day

17 sekund po obudzeniu się- 17 seconds after waking up

Modlę się- I pray

Medytacja pomaga mieć lepszą energię na cały dzień- Meditation helps you have better energy for the day

Myślę co będę robił dzisiaj- I think what I will do today

Medytacją może być całe życie- Meditation can be a whole life

Planuję cały dzień- I plan all day

Podkreślam co jest ważne- I emphasize what is important

Piszę afirmację- I am writing an affirmation

Afirmujesz o poranku?- Do you affirm in the morning?

Jesteśmy jak magnez- We are like magnesium

Robię wizualizację- I do a visualization

Filiżanka kawy o poranku- A cup of coffee in the morning

Robię ćwiczenia gimnastyczne- I do gymnastic exercises

Uprawianie jogi- Practicing yoga

Spacer- Walk

Prysznic- Shower

Picie wody- Drinking water


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #learnpolishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Góry to moja największa miłość - Mountains are my greatest love.

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Góry to moja największa miłość - Mountains are my greatest love

Wolicie góry czy morze? - Do you prefer mountains or the sea?

Często jeździsz w góry? - Do you often go to the mountains?

Góry dają poczucie wolności - Mountains give a sense of freedom

Jadę w góry - I'm going to the mountains

Być w górach - To be in the mountains

Chodzimy po górach - We walk in the mountains

Specjalne ubranie i sprzęt w górach - Special clothing and equipment in the mountains

Odzież termiczna - Thermal clothing

Podziwiać góry - Admire the mountains

Szczyt góry - Top of the mountain

Wspinać się - Climb

Park linowy, ścianka wspinaczkowa - Rope park, climbing wall

Wędrować po górach - To hike in the mountains


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #learnpolishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Słońce - Sun.

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Słońce- Sun

Latem świeci słońce- The sun is shining in the summer

Ludzie lubią opalać się- People like to sunbathe

Siedzisz na fotelu i czytasz książki- You sit in the armchair and read books

Leżeć na słońcu- Lie in the sun

Ty jesteś aktywną osobą- You are an active person

Spacerować po plaży- Walk on the beach

Ludzie idą kąpać się w morzu- People go to bathe in the sea

Ludzie potrzebują ręcznika kiedy wychodzą z morza- People need a towel when they come out of the sea

Leżeć na ręczniku lub na kocu- Lie on a towel or blanket

Strój do pływania- Swimming suit

Musimy mieć balsam do opalania- We must have a tanning lotion

Okulary przeciwsłoneczne- Sunglasses

Oparzenie słoneczne- Sunburn

Miałeś kiedyś oparzenie słoneczne?- Have you ever had a sunburn?


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Idziemy do miasta - We go to the city.

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Idziemy do miasta- We go to the city

Korek (godzina szczytu)- Traffic jam (rush hour)

Wolę pojechać po godzinie szczytu- I prefer to drive after the rush hour

Most- Bridge

Chodnik (miejsce dla ludzi żeby chodzić)- Sidewalk (place for people to walk)

Przejście dla pieszych- Zebra crossing

Ścieżka rowerowa- Bicycle path

Samochód chce skręcić w prawo- The car wants to turn right

Ludzie nie patrzą czy jedzie samochód- People do not look if the car is driving

Rowery jadą bardzo szybko- The bikes go very fast

Rondo- Roundabout

Skrzyżowanie- Intersection


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Wypożyczalnia samochodu - Car rental.

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Wypożyczalnia samochodu - Car rental

Chcę wypożyczyć samochód - I want to rent a car

Na jak długo? - For how long?

Na dobę - Per day

Na trzy dni - For three days

Na tydzień - For a week

Jaki jest koszt wypożyczenia auta na dobę? - What is the cost of renting a car per day?

Zależy jaka marka, jaki silnik - It depends on what brand, what engine

Ile wynosi kaucja? - How much is the deposit?

Czy auto ma ubezpieczenie? - Does the car have insurance?

Jakiej klasy samochody macie? - What class of cars do you have?

Klasa A (małe auta miejskie) - Class A (small city cars)

Klasa B (średniej wielkości samochody) - Class B (mid-size cars)

Klasa C (duże samochody osobowe) - Class C (large passenger cars)

Auta do przewozu ludzi - Cars for transporting people

Auto dostawcze - Delivery car


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Basen (pływalnia) - Swimming pool.

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Basen (pływalnia) - Swimming pool

Na basenie pływamy - We swim in the pool

Czy umiesz pływać? - Can you swim?

Możesz zapisać się na kurs pływania - You can sign up for a swimming course

Ja pływam w basenie - I'm swimming in the pool

Ocean - Ocean

Czy często chodzisz na basen? - Do you often go to the swimming pool ?

Jeżdżę na basen z synem - I go to the swimming pool with my son

Zjeżdżalnia wodna - Waterslide

Różne style pływackie - Various swimming styles

Możemy pływać kraulem, żabką - We can crawl, frog

Pływać pieskiem - To paddle


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Akweny- Aquatic.

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Akweny - Aquatic

Co zrobić jak jest bardzo gorąco? - What to do when it's very hot?

Morze, jezioro, rzeka - Sea, lake, river

Jadę nad morze - I'm going to the sea

Jestem nad morzem - I am at the seaside

Pływam w morzu - I'm swimming in the sea

Jak często jeździsz nad morze? - How often do you go to the seaside?

Jadę nad jezioro - I'm going to the lake

Jestem nad jeziorem - I am by the lake

Pływam w jeziorze - I'm swimming in the lake

W jeziorze jest bakteria - There is a bacterium in the lake

Musimy mieć oczy szeroko otwarte - We must keep our eyes open

Jadę nad rzekę - I'm going to the river

Jestem nad rzeką - I'm on the river

Pływam w rzece - I swim in the river


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Idiomy związane ze zwierzętami - Idioms related to animals.

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Idiomy związane ze zwierzętami - Idioms related to animals

Głodny jak wilk - Hungry as a wolf

Zdrowy jak ryba - As fit as a fiddle

Silny jak koń - Strong as a horse

Wierny jak pies - Faithful as a dog

Pracowity jak mrówka - Hardworking as an ant

Biedny jak mysz kościelna - Poor as a church mouse

Dumny jak paw - Proud as a peacock


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Kim jesteś z zawodu?- What's your occupation?.

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 20% Discount.

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Praca - Work

Przerwa w pracy - Break at work

Praca jest moją pasją - Work is my passion

Kim jesteś z zawodu? - What's your occupation?

Jestem przedsiębiorcą - I am an entrepreneur

Mam swoją firmę - I have my business

Jestem nauczycielką - I'm teacher

Jestem trenerem - I am a trainer

Jestem kelnerką, pracuję w restauracji - I am a waitress, I work in a restaurant

Jestem mechanikiem, pracuję w warsztacie samochodowym - I am a mechanic, I work in a car repair shop

Jestem pielęgniarzem/pielęgniarką - I am a nurse

Jestem kierowcą - I am a driver

Jestem kucharzem - I am a cook

Jestem taksówkarzem - I am a taxi driver

Jestem kosmetyczką - I am a beautician

Jestem sprzedawcą - I am a seller

Nauczycielka historii, języka angielskiego - History, English teacher

Tłumacz - Translator

Urzędnik - Clerk

Fryzjer - Hairdresser

Prawnik - Lawyer

Psycholog - Psychologist

Lekarz - Doctor

Dentysta - Dentist


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Przymierzalnia i Poczekalnia - Changing room & Waiting room.

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 20% Discount.

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Przymierzalnia - Changing room

Poczekalnia - Waiting room

Przymierzyć sukienkę - Try on a dress

Gdzie jest przymierzalnia? - Where's the changing room?

Poczekalnia to miejsce gdzie czekamy - The waiting room is a place where we wait

Siedzimy w poczekalni - We are sitting in the waiting room

W poczekalni jest czas na czytanie gazet - There is time to read newspapers in the waiting room

W poczekalni możemy do kogoś zadzwonić - In the waiting room we can call someone

W tej przychodni jest duża poczekalnia - This clinic has a big waiting room

Pacjenci czekają w poczekalni - Patients are waiting in the waiting room


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

czerwca to pierwszy dzień lata - June 21 is the first day of summer.

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 20% Discount.

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

21 czerwca to pierwszy dzień lata - June 21 is the first day of summer

Cztery pory roku: wiosna, lato, jesień, zima - Four seasons: spring, summer,

autumn, winter

Lato to moja ulubiona pora roku - Summer is my favorite season

Najdłuższy dzień w roku - The longest day of the year

Wakacje - Holidays

Okulary przeciwsłoneczne - Sunglasses

Czapka, kapelusz przeciwsłoneczny - Cap, sun hat

Czy Ty masz kapelusz czy czapkę? - Do you have a hat or a cap?

Kostium kąpielowy jest dla kobiety -The swimsuit is for women

Kąpielówki dla mężczyzny -Swim trunks for a man

Walizka -Suitcase

Musimy spakować ubrania, dokumenty - We need to pack clothes, documents

Parasol plażowy - Beach umbrella

Krem przeciwsłoneczny - Sunscreen

Planujemy wycieczki nad morze, w góry - We are planning trips to the seaside, to the mountains


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

miejscownik Przyimki - locative Prepositions.

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 20% Discount.

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Powtarzamy miejscownik - We repeat the locative

Przyimki - Prepositions

Gdzie jesteś? - Where are you?

Teraz jestem na poczcie, na uniwersytecie - Now I'm at the post office, at the university

Gdzie mieszkasz? - Where do you live?

Mieszkam w Polsce, w Irlandii, w Ameryce - I live in Poland, Ireland, America

Jestem w przy Tobie - I'm in with you

Jestem przy banku, przy sklepie - I am at the bank, at the store

Siedzę przy biurku - I am sitting at the desk

Jestem po obiedzie - I'm after lunch

Jestem po pracy, po lekcji - I'm after work, after school

O kim myślisz? - Who are you thinking about?

Myślę o mojej rodzinie, o mojej żonie - I think about my family, about my wife

O czym myślisz? - What are you thinking about?

Myślę o gramatyce, o polityce - I think about grammar, about politics

O czym lubisz rozmawiać? - What do you like to talk about?

Lubię rozmawiać o polityce, o historii - I like to talk about politics, about history


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Start your own Podcast https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Zatłoczony, zajęty - Crowded, Busy (occupied).

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Start Your Own Podcast + Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Zatłoczony, zajęty - Crowded, Busy (occupied)

Toaleta jest zajęta - The toilet is occupied

To miejsce jest zajęte - This place is occupied

Stolik w restauracji jest zajęty - Restaurant table is occupied

My jesteśmy bardzo zajęci, dużo pracujemy - We are very busy, we work a lot

Ludzie mają dużo wolnego czasu - People have a lot of free time

Jestem zajęty, nie mam czasu - I'm busy, I don't have time

Mam dużo pracy, jestem zajęty - I have a lot of work, I'm busy

Musimy znaleźć balans - We have to find a balance

Czy jesteś zajęty dzisiaj wieczorem? - Are you busy tonight?

Czy to miejsce jest wolne? - Is this seat free?

Ulice miasta są zatłoczone - The city streets are crowded

Musimy stać w korku - We have to stand in a traffic jam

Nie lubię zatłoczonych miejsc - I don't like crowded places

Parking jest zatłoczony i nie ma gdzie zaparkować - Parking is crowded and nowhere to park

W zatłoczonym pociągu nie było wolnych miejsc - There were no free places in the crowded train


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Czerwiec to jest piękny miesiąc - June is a beautiful month.

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Social Media & Donations https://bio.link/podcaster

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 20% Discount.

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Czerwiec to jest piękny miesiąc - June is a beautiful month

Czerwiec to jest początek lata - June is the beginning of summer

W czerwcu jest koniec szkoły i początek wakacji - In June it is the end of school and the beginning of summer holidays

W czerwcu nosimy letnie ubrania - In June, we wear summer clothes

Czerwiec to wycieczki nad morze, w góry - June is trips to the sea, to the mountains

Więcej czasu na świeżym powietrzu - More time outdoors

Więcej czas spędzamy na dworze - We spend more time outside

Dużo pracy w ogrodzie - Lots of work in the garden

Możemy jeść śniadanie w ogrodzie - We can eat breakfast in the garden

Robić grilla- Make a barbecue

W czerwcu mamy pyszne sezonowe owoce i warzywa - In June, we have delicious seasonal fruits and vegetables

Czerwiec ma najdłuższy dzień w roku - June has the longest day of the year

W czerwcu jest Dzień Ojca - In June there is Father's Day


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Dzień Dziecka (1 czerwca) - Children's Day (June 1st).

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Social Media & Donations https://bio.link/podcaster

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 20% Discount.

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Dzień Dziecka ( 1 czerwca) - Children's Day (June 1st)

Traktujemy nasze dzieci szczególnie- We treat our children especially

Idziemy do ZOO- We go to the zoo

Idziemy do parku na spacer- We're going to the park for a walk

Idziemy na rower- We're going for a bike

Idziemy do lunaparku- We're going to the funfair

Idziemy na lody, na ciastko- We go for ice cream, for cake

Idziemy na basen- We are going to the swimming pool

Kupujemy zabawki, słodycze- We buy toys, sweets

Mój syn chciał bluzę- My son wanted a sweatshirt

Życzymy dużo radości, szczęścia, uśmiechu- We wish you a lot of joy, happiness, smile

Życzymy bajkowego życia- We wish you a fairy-tale life

W szkole nie ma lekcji- There are no lessons at school

Dzieci mają dzień sportu- Children have a sports day

Każdy z nas ma w sobie wewnętrzne dziecko- Each of us has an inner child inside us


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Przymierzac( to try on ) & Probowac (to try).

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Social Media & Donations https://bio.link/podcaster

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 20% Discount.

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Przymierzać ubrania- Try on clothes

Ja przymierzam bluzkę- I'm trying on a blouse

Przepraszam , czy mogę przymierzyć tę koszulę?- Excuse me, can I try this shirt on?

Przymierzalnia- Changing room

Ona przymierzyła niebieską sukienkę- She tried on a blue dress

Przymierz ten garnitur- Try on this suit

Zawsze próbuję zupę przed podaniem- I always try the soup before serving

Spróbuj, na pewno będzie Ci smakować- Try it, you will surely like it

Próbować grać na gitarze- Try to play the guitar

Próbować jeździć na rowerze- Try to ride a bike


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Jaki są Twoje marzenia?- What are your dreams?.

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Social Media & Donations https://bio.link/podcaster

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 20% Discount.

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Jaki są Twoje marzenia?- What are your dreams?

Marzyć o- Dream about

O czym marzysz?- What are you dreaming about?

Marzę o wakacjach- I dream about holidays

Marzę o lecie- I dream of summer

Marzę o nowym domu- I dream of a new home

Marzę o nowym samochodzie- I dream of a new car

Marzymy o dobrej pracy- We dream of a good job

Marzymy o dużych pieniądzach- We dream of big money

Marzymy o idealnym partnerze- We dream of a perfect partner

Marzymy o szczęściu, zdrowiu- We dream of happiness, health

Marzymy o podróżach- We dream of traveling

Marzę o spokoju, harmonii- I dream of peace, harmony

Marzenie jest bardzo blisko- The dream is very close

Marzenie, a cel- A dream and a goal

Marzenie zaczyna się w głowie- A dream begins in the head

Moim marzeniem jest nowy biznes- My dream is a new business

Marzę o karierze w sztuce- I dream of a career in art

Chciałbym robić wszystko co chcę- I would like to do whatever I want


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Czy żyjesz ekologicznie? - Do you live ecologically?.

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Social Media & Donations https://bio.link/podcaster

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 20% Discount.

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Czy żyjesz ekologicznie? - Do you live ecologically?

Możemy jeździć na rowerze - We can ride a bicycle

W mieście jest dużo samochodów - There are a lot of cars in the city

Segregować śmieci - Segregate garbag

Jestem wegetarianką (dieta roślinna, owoce i warzywa) - I am a vegetarian (plant-based diet, fruits and vegetables)

Oszczędzam prąd i wodę - I save electricity and water

Nie włączamy wszędzie światła - We don't turn on the light everywhere

Kupuję rzeczy wielokrotnego użytku - I buy reusable things

Działam w organizacjach ekologicznych - I work in environmental organizations

Kupujemy produkty BIO - We buy BIO products

Nie wyrzucam śmieci na ulicy, w lesie - I do not throw away garbage on the street, in the forest


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

kiedy masz gorszy dzień? - When you have a bad day?.

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Social Media & Donations https://bio.link/podcaster

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 20% Discount.

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Pięć rzeczy do zapamiętania - Five things to remember

Gorszy dzień - Worse day

Kupić litr lodów - Buy a liter of ice cream

Zjeść całą czekoladę - Eat all the chocolate

Co robisz kiedy masz gorszy dzień? - What do you do when you have a bad day?

Słucham dobrej muzyki - I listen to good music

Idę na spacer - I'm go for a walk

Rozmawiam z dobrymi przyjaciółmi - I talk to good friends

Dobre i złe dni są tylko częścią życia - Good days and bad days are only part of life

Nie zawsze jest tak źle jak myślisz - It's not always as bad as you think

Ta lekcja Cię czegoś nauczy - This lesson will teach you something

Jest w porządku, to minie - It's okay, it will pass

Postęp nie może być zawsze widoczny - Progress cannot always be seen

Musimy poczekać na rezultaty - We have to wait for the results

Robię rzeczy dla siebie - I do things for myself

Myśleć pozytywnie - Think positive


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Gotować, przygotować - Cook, prepare.

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Social Media & Donations https://bio.link/podcaster

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 20% Discount.

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Gotować, przygotować - Cook, prepare

Lubisz gotować? - Do you like cooking?

Codziennie gotuję obiad - I cook dinner every day

Wczoraj ugotowałem zupę - Yesterday I cooked soup

Przygotuję coś dobrego na obiad - I'll prepare something good for dinner

Muszę przygotować się do egzaminu - I need to prepare for the exam

Zawsze jestem przygotowany - I am always prepared

Jestem gotowy - I am ready

Jestem gotowy i przygotowany - I am ready and prepared


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Usługi - Services.

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Social Media & Donations https://bio.link/podcaster

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 20% Discount.

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Usługi- Services

Z jakich usług najczęściej korzystacie? - Which services do you most often use?

Fryzjer - Hairdresser

Szewc - Shoemaker

Krawiec - Tailor

Mechanik samochodowy - Car mechanic

Warsztat samochodowy - Car repair shop

Ksero - Photocopying

Optyk - Optician

Chodzę do fryzjera dwa razy w miesiącu - I go to the hairdresser twice a month

Chodzę do szewca - I go to the shoemaker

Zaprojektowałem moje własne buty - I designed my own shoes

Nie korzystam z usług krawcowej - I do not use the services of a tailor

Często korzystam z warsztatu samochodowego - I often use a car repair shop


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Co lubisz robić?- What do you like to do?.

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Social Media & Donations https://bio.link/podcaster

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 20% Discount.

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Co lubisz robić?- What do you like to do?

Czy lubić grać w szachy?- Do you like playing chess?

Czy lubisz grać na gitarze?- Do you like playing guitar?

Czy lubisz biegać?- Do you like running?

Czy lubisz gotować?- Do you like cooking?

Czy lubisz jeździć na nartach?- Do you like skiing?

Czy lubisz jeździć na motorze?- Do you like riding a motorbike?

Czy lubisz czytać książki?- Do you like reading books?

Czy lubisz robić zdjęcia?- Do you like taking photos?

Czy lubisz malować?- Do you like painting?

Czy lubisz pływać?- Do you like swimming?

Czy lubisz śpiewać?- Do you like singing?

Czy lubisz podróżować?- Do you like to travel?


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Pytania - Questions.

Find all Graphics to freely Download https://www.facebook.com/learnpolishpodcast

Social Media & Donations https://bio.link/podcaster

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 20% Discount.

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Kto to jest? - Who is this?

Kto lubi lody? - Who likes ice cream?

Kto jest z Polski? - Who is from Poland?

Kogo kochasz? - Who do you love?

Kogo widzisz? - Who do you see?

Komu ufasz? - Who do you trust?

Komu wierzysz? - Who do you believe?

Z kim pracujesz? - Who are you working with?

Z kim mieszkasz? - Who do you live with?

Z kim lubisz spędzać czas? - Who do you like to spend time with?

O kim myślisz? - Who are you thinking about?

Co lubisz? - What do you like?

Co pijesz? - What are you drinking?

Czego nie lubisz? - What do you dislike?

Czego nie jesz? - What are you not eating?

Czemu nie pracujesz? - Why are you not working?

Z czym masz pizzę? - What do you have your pizza with?

Po co idziesz do sklepu? - Why are you going to the store?

Jak się masz? - How are you?

Jak się nazywasz? - What is your name?

Gdzie mieszkasz? - Where do you live?

Gdzie pracujesz? - Where do you work?

Dokąd jedziesz na wakacje? - Where are you going on vacation?

Kiedy masz lekcje? - When are your lessons?

Kiedy masz urodziny? - When's your birthday?

Ile masz lat? - How old are you?

Jak długo mieszkasz w Polsce? - How long do you live in Poland?

Dlaczego mieszkasz w Polsce? - Why do you live in Poland?

Skąd jesteś? - Where are you from?


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Pracować na etacie - Work full-time.

Social Media & Donations https://bio.link/podcaster

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 20% Discount.

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Pensja (wynagrodzenie, zarobki) - Salary

Pieniądze za pracę - Money for work

Wydawać pieniądze - Spend money

Płacić za coś - Pay for something

Kupować coś - Buy something

Oszczędzać pieniądze - Save money

Pracować na etacie - Work full-time

Pracować na własny rachunek (mieć swoją firmę) - Be self-employed (have your own business)

Mieć urlop - Have a vacation

Czy Ty wolisz wydawać pieniądze czy oszczędzać pieniądze? - Do you prefer to spend money or save money?

Czy wolisz pracować na etacie czy na własny rachunek? - Do you prefer to work full-time or self-employed?

Emerytura - Pension


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Majówka - May long weekend.

Social Media & Donations https://bio.link/podcaster

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 20% Discount.

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Majówka - May long weekend

Jedziemy na urlop - We're going on vacation

1 maja jest Święto Pracy - May 1 is Labor Day

3 maja jest Święto Konstytucji - May 3 is the Feast of the Constitution

Polskie morze - Polish sea

Polskie góry - Polish mountains

Polacy organizują pikniki - Poles organize picnics

Robić grilla - Make a barbecue

Jakie masz plany na majówkę? - What are your plans for the May weekend?

Jadę na plażę do Gdyni - I'm going to the beach in Gdynia

Jadę w góry - I'm going to the mountains


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Sklep spożywczy - Grocery store.

Social Media & Donations https://bio.link/podcaster

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 20% Discount.

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Ilość - Amount

Sklep spożywczy - Grocery store

Tabliczka czekolady - Bar of chocolate

Kromka chleba - Slice of bread

Pudełko czekoladek - Box of chocolates

Pudełko herbaty - Tea box

Zgrzewka wody, piwa - A pack of water, beer

Karton mleka - Carton of milk

Puszka fasoli, pomidorów, piwa - A can of beans, tomatoes, beer

Słoik miodu, ogórków - A jar of honey, cucumbers

Butelka wina, wody - A bottle of wine, water

Plasterek sera, szynki - A slice of cheese, ham

Torebka ryżu - Rice bag

Paczka chipsów - A pack of crisps

Paczka papierosów - Pack of cigarettes


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Przybory biurowe - Office supplies.

My Other Podcasts, Social Media & Donations https://bio.link/podcaster

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Biuro - Office

Przybory biurowe - Office supplies

Nożyczki - Scissors

Zakreślacz - Highlighter

Temperówka - Pencil sharpener

Teczka - Folder

Notes - Notebook

Kredki - Crayons

Taśma klejąca - Adhesive tape

Piórnik - Pencil box

Linijka - Ruler

Długopis - Pen

Klej - Glue

Gumka - Rubber

Kolorowe mazaki - Colored markers

Ołówek z gumką - Pencil with rubber

Klips - Clip

Kalendarz - Calendar

Zeszyt - Notebook

Zszywacz - Stapler

Spinacze - Paper clips

Pineski - Drawing pins

Pędzel - Brush


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Pogawędka - Small talk.

Social Media & Donations https://bio.link/podcaster

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 20% Discount.

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Pogawędka - Small talk

Jak się czujesz? - How are you?

Co robiłeś wczoraj wieczorem? - What were you doing yesterday evening?

Jak długo stałeś w korku? - How long have you been in traffic jam?

Co będziesz robić w weekend? - What will you do on the weekend?

Czy jutro będziesz musiał wstać wcześnie rano? - Will you have to get up early in the morning tomorrow?

Spod jakiego znaku zodiaku jesteś? - What sign of the zodiac are you?

Gdzie leży Twój kraj? - Where is your country located?

Gdzie pracujesz? - Where do you work?

Jak dojechać do Twojej pracy? - How to get to your work?

Gdzie chętnie spędzasz wakacje? - Where do you like to spend your vacation?

Jak wygląda Twoje mieszkanie? - What does your apartment look like?

Parter i dwa piętra - Ground floor and two floors

Jest piękny ogród - There is a beautiful garden

Jaka jest Twoja ulubiona pora roku? - What is your favourite season?

Jaka jest dzisiaj pogoda? - What is the weather today?

Czy uprawiasz sport? - Do you play sports?

Jaką dyscyplinę sportową lubisz najbardziej? - What kind of sport do you like the most?

Czy lubisz uczyć się polskiego? - Do you like learning Polish?

Czy masz swoją wizytówkę? - Do you have your business card?


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Podstawowe przyimki - Basic prepositions.

Social Media & Donations https://bio.link/podcaster

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 20% Discount.

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Przyimki- Prepositions

Podstawowe przyimki - Basic prepositions

Piłka jest przy trójkącie - The ball is next to the triangle

Jestem przy banku - I'm next to the bank

Piłka jest na kwadracie - The ball is on the square

Komputer jest na stole - The computer is on the table

Piłka jest pod trójkątem - The ball is under the triangle

Piłka jest nad prostokątem - The ball is above the rectangle

Lampa wisi nad stołem - The lamp hangs over the table

Piłka jest za kwadratem - The ball is behind the square

Za bankiem jest parking - There is a parking behind the bank

Piłka jest w prostokącie - The ball is in a rectangle

Jestem w teatrze, w pracy - I'm at the theater, at work

Jestem przed domem, kinem - I'm in front of the house, the cinema

Piłka jest między trójkątami - The ball is between triangles

Kwiaty są między książkami - The flowers are between the books

Jestem obok mojego mikrofonu - I'm next to my microphone

Jestem obok biurka - I am next to the desk

Piłka jest przy trójkącie - The ball is next to the triangle

Piłka jest w prostokącie - The ball is in a rectangle

Piłka jest pod/nad trójkątem - The ball is under / over the triangle

Piłka jest nad prostokątem - The ball is above the rectangle

Koło jest obok kwadratu - The circle is next to the square

Piłka jest między trójkątami - The ball is between triangles


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Lekarze specjaliści - Specialist doctors.

Social Media & Donations https://bio.link/podcaster

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 20% Discount.

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Lekarze specjaliści - Specialist doctors

Boli mnie ząb - My tooth hurts

Boli Cię głowa - You have a headache

Boli go brzuch - He has a stomachache

Co Cię boli? - What hurts you?

Często boli ją serce - Her heart often hurts

Boli go żołądek - His stomach hurts

Co Panią boli? - What hurts you?

Bolą nas plecy - Our back hurts

Dzieci bolą zęby - Children hurt their teeth

Boli go gardło - His throat hurts

Pediatra leczy dzieci - Pediatrician treats children

Internista to lekarz ogólny - An internist is a general doctor

Okulista leczy oczy - The ophthalmologist treats the eyes

Laryngolog leczy gardło i uszy - The laryngologist treats the throat and ears

Stomatolog leczy zęby - The dentist treats the teeth

Neurolog kontroluje pracę mózgu i sytemu nerwowego - A neurologist controls the work of the brain and nervous system

Kardiolog leczy serce - A cardiologist treats the heart

Ginekolog to lekarz dla kobiet - A gynecologist is a doctor for women

Ortopeda leczy kręgosłup i złamania - Orthopedist treats spine and fractures

Dermatolog leczy choroby skóry - A dermatologist treats skin diseases

Psycholog leczy depresję - A psychologist treats depression


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Święta Wielkanocne - Easter.

Social Media & Donations https://bio.link/podcaster

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 20% Discount.

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Wiosna - Spring

Święta Wielkanocne - Easter

Malujemy pisanki - We paint Easter eggs

Biały baranek (plastikowy lub cukrowy) - White lamb (plastic or sugar)

Jajka - Eggs

Post (nie jemy mięsa) - Fasting (we do not eat meat)

Koszyk Wielkanocny - Easter basket

Niedziela Palmowa - Palm Sunday

Rzeżucha - Cress

Kurczaczek - Little chicken

Żonkile - Daffodils

Święconka - Easter basket

Tulipany - Tulips

Hiacynty - Hyacinths

Zajączek - Bunny

Babka (ciasto) - Babka cake

Mazurek - Mazurek cake

Biała kiełbasa - White sausage

Żurek w chlebie - Sour soup in bread

Bazie - Base

Pocztówka - Postcard


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Things to do in the kitchen - Co robić w kuchni.

Social Media & Donations https://bio.link/podcaster

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 20% Discount.

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Kuchnia- Kitchen

Ubić jajka- Beat the eggs

Wymieszać zupę- Stir the soup

Pokroić chleb- Cut the bread

Upiec ciasto- Bake a cake

Gotować jedzenie- Cook food

Pozmywać naczynia- Wash the dishes

Zetrzeć ser- Grate cheese

Obrać jabłko- Peel an apple

Wlać mleko- Pour in the milk

Pić mleko z butelki- Drink milk from a bottle

Usmażyć jajko- Fry an egg

Zmiksować krem- Mix the cream

Umyć marchewkę- Wash the carrot

Posiekać szczypiorek- Chop the chives

Rozpuścić masło- Melt the butter

Przecedzić makaron- Strain the pasta

Wsypać cukier- Pour sugar


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Sprzęt kuchenny - Kitchenware.

Social Media & Donations https://bio.link/podcaster

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 20% Discount.

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Naczynia kuchenne- Kitchen dishes

Sprzęt kuchenny- Kitchenware

Wyciskacz do czosnku- Garlic squeezer

Nóż- Knife

Garnek- Pot

Blacha do piekarnika- Oven tray

Naczynie żaroodporne- Heat-resistant dish

Tarka- Grater

Talerz- Plate

Łyżka do lodów- Ice cream spoon

Patelnia- Pan

Dzbanek- Pitcher

Miseczka- Bowl

Kieliszek do jajek- Egg cup

Szklanka- Glass

Kieliszek do wina- Wine glass

Dzbanek do herbaty- Tea pot

Filiżanka- Cup

Kubek- Mug

Sztućce (widelec, nóż, łyżka)- Cutlery (fork, knife, spoon)

Obierak- Peeler

Trzepaczka do jajek- Egg beater


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Symbole wiosny - Spring symbols.

Social Media & Donations https://bio.link/podcaster

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 20% Discount.

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Symbole wiosny - Spring symbols

Kwitnące kwiaty - Blooming flowers

Piękne zapachy - Beautiful fragrances

Wielkanoc - Easter

Święto religijne - Religious holiday

Malujemy jajka - We paint eggs

Wiosną mamy więcej aktywności fizycznej - In spring we have more physical activity

Jeździć na rowerze, na rolkach - Ride a bike, roller-skating

Spędzać więcej czasu na zewnątrz - Spend more time outside

Słońce dodaje na energii do życia - The sun gives energy to life

Bociany wiosną wracają do Polski - The storks return to Poland in spring

Bocian to symbol dziecka - The stork is a symbol of a child

Bazie - Base

Cieszymy się wiosną - We enjoy spring


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Lekarskie polecenia - Medical orders Part II.

Social Media & Donations https://bio.link/podcaster

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 20% Discount.

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Polecenia lekarskie- Medical orders

Proszę zgiąć rękę- Please bend your arm

Proszę wyprostować rękę- Please straighten your hand

Proszę podnieść ręce- Please raise your hands

Proszę opuścić ręce- Please put your hands down

Proszę otworzyć szeroko oczy- Please open your eyes wide

Proszę nie mrugać- Please don't blink

Proszę otworzyć szeroko usta- Please open your mouth wide

Proszę pokazać język- Please show the tongue

Proszę wysunąć język- Please stick out your tongue

Proszę wziąć głęboki oddech- Please take a deep breath

Proszę zrobić wydech- Please exhale

Proszę zakasłać- Please cough

Proszę się nie ruszać- Please don't move

Proszę policzyć do dziesięciu- Please count to ten

Proszę spojrzeć na mój palec- Please look at my finger


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Lekarskie polecenia - Medical orders.

Social Media & Donations https://bio.link/podcaster

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 20% Discount.

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Lekarskie polecenia- Medical orders

Proszę wejść- Please come in

Proszę usiąść- Please sit down

Proszę wstać- Please stand up

Proszę podwinąć rękaw- Please roll up your sleeve

Proszę zdjąć buty- Please take off your shoes

Proszę zdjąć skarpetki- Please take off your socks

Proszę rozebrać się do pasa- Please undress to the waist

Proszę się ubrać- Please dress up

Proszę położyć się na kozetce- Please lie down on the couch

Proszę obrócić się- Please turn around

Proszę rozluźnić się- Please relax


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Detoks, oczyszczanie - Detox, cleansing.

Social Media & Donations https://bio.link/podcaster

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 20% Discount.

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/


In this Episode we discuss:

Detoks, oczyszczanie - Detox, cleansing

Wiosenne oczyszczanie - Spring detox

Sześć kroków - Six steps

Zrezygnuj z kawy - Give up coffee

Jedna kawa dziennie - One coffee a day

Jedz surowe warzywa i owoce - Eat raw vegetables and fruits

Bardzo dużo witamin - A lot of vitamins

Bardzo rzadko jem surowe warzywa - I eat raw vegetables very rarely

Ruszaj się - Move

Uprawiaj sport - Do sport

Nie mamy ruchu - We have no movement

Zimą mamy więcej kilogramów - In winter, we have more kilos

Ogranicz spożywanie cukru i soli - Limit sugar and salt consumption

Jedz lekkie kolacje - Eat light suppers

Jemy wolno, nie szybko - We eat slowly, not fast

Pij świeże soki - Drink fresh juices


If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcas

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Dzień Świętego Patryka- St. Patrick's Day.

Social Media & Donations https://bio.link/podcaster

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 20% Discount.

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Dzień Świętego Patryka- St. Patrick's Day

17 marca jest Dzień Świętego Patryka- March 17 is St. Patrick's Day

Irlandzkie święto narodowe i religijne- Irish National and Religious Day

Jak świętują Irlandczycy?- How do the Irish celebrate?

Irlandczycy noszą ubrania w kolorze zielonym- Irish people wear green clothes

Zielony to narodowy kolor Irlandii- Green is the national colour of Ireland

Bardzo zielona wyspa- A very green island

Parady uliczne- Street parades

Koniczyna- Shamrock

Kapelusz- Hat

Koniczyna to szczęście- Shamrock is a luck

Święty Patryk był biskupem- Saint Patrick was a bishop

Harfa- Harp

Koniczyna ma symbol Trójcy Świętej- The shamrock has the symbol of the holy trinity

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Napisy informacyjne w miejscach publicznych- Information inscriptions in public places

.

Social Media & Donations https://bio.link/podcaster

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 20% Discount.

All other Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Napisy informacyjne w miejscach publicznych- Information inscriptions in public places

Wejście- Entry

Wyjście, wyjazd- Exit

Wjazd na parking- Entry to the parking

Szatnia damska, męska- Women's and men's cloakroom

Poczekalnia- Waiting room

Pokój dla matki z dzieckiem- A room for a mother with a child

Toaleta damska, męska- Toilet for women, men

Teren monitorowany- Monitored area

Zakaz naklejania ogłoszeń- Prohibition of sticking advertisements

Przejście na perony- Passage to the platforms

Wstęp wolny- Free amission

Wstęp po okazaniu biletu- Admission upon presentation of the ticket

Pchaj-Push

Ciągnij-Pull

Zakaz palenia- No smoking

Wyjście ewakuacyjnie- Emergency exit

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about Pokój na świecie - World peace.

To get the Court Course Mentioned in this Episode - How To Win in Court Its at the top of this link https://bio.link/podcaster

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 20% Discount.

All Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Pokój na świecie- World peace

Co możemy robić żeby był pokój na świecie?- What can we do to bring peace in the world?

Brak wojen- No wars

Nie sprzedawać broni- Don't sell guns

Wojna to największe zło- War is the greatest evil

Brak konfliktu o władzę, pieniądze- No conflict over power, money

Brak przemocy- No violence

Brak rasizmu- No racism

Powinniśmy się szanować- We should respect each other

Szacunek dla ludzkiego życia- Respect for human life

Szacunek do innych kultur, religii- Respect for other cultures, religions

Tolerancja i akceptacja- Tolerance and acceptance

Ludzie chcą władzy- People want power

Modlimy się za pokój na świecie- We pray for peace in the world

Donations to the Ukraine as Discussed.

https://gajusz.org.pl/en/

Give the name Anastasia Derecha on the Transfer to ensure it goes for Ukraine help.

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about Ukraina - (Ukraine).

To get the Court Course Mentioned in this Episode - How To Win in Court Its at the top of this link https://bio.link/podcaster

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 20% Discount.

All Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Martwić się- Worry

Pomoc- Help

Wsparcie- Support

Solidarność- Solidarity

Empatia- Empathy

Możemy wpłacić pieniądze- We can deposit money

Możemy zaprosić do naszego domu- We can invite you to our home

Ludzie udostępniają swój dom- People share their home

Możemy kupić produkty, jedzenie, ubrania, kosmetyki- We can buy products, food, clothes, cosmetics

Możemy pomóc w nauce języka polskiego- We can help to learn Polish

Darmowe lekcje języka polskiego- Free Polish language lessons

Możemy pomóc w adaptacji w nowym kraju- We can help with adaptation in a new country

Możemy pomóc znaleźć pracę- We can help you find a job

Musimy wspierać się wszyscy razem- We must all support each other

Donations to the Ukraine as Discussed.

https://gajusz.org.pl/en/

Give the name Anastasia Derecha on the Transfer to ensure it goes for Ukraine help.

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about To jest sąd- This is the court.

To get the Court Course Mentioned in this Episode - How To Win in Court Its at the top of this link https://bio.link/podcaster

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 10% Discount.

All Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Sąd- Court

To jest sąd- This is the court

Idę do sądu- I'm going to court

Jestem w sądzie- I'm in court

Sala sądowa (rozpraw)- Courtroom

Sędzia wydaje wyrok- The judge gives the verdict

Wysoki Sądzie- Your Honor

Adwokat broni- The lawyer defends

Prawnik- Lawyer

Prokurator udowadnia winę- The prosecutor proves guilt

Ława przysięgłych - Jury

Oskarżony jest winny / niewinny- The accused is guilty / innocent

Sprawa sądowa (sprawa rozwodowa, morderstwo)- Court case (divorce case, murder)

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about Tłusty czwartek - (Fat Thursday).

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 10% Discount.

All Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Tłusty czwartek- Fat Thursday

Tłuste mleko, masło- Fatty milk, butter

Pączki- Doughnuts

Polacy jedzą pączki- Poles eat doughnuts

Pączki z marmoladą- Doughnuts with marmalade

Pączki z toffi- Toffee doughnuts

Pączki z dżemem- Doughnut swith jam

Pączki z budyniem- Pudding doughnuts

Pączki z bitą śmietaną- Whipped cream doughnuts

Ile kalorii mają pączki?- How much calories do doughnuts have?

Ludzie kupuję w sklepach pączki- People buy doughnuts in shops

Ludzie smażą pączki w domu- People fry doughnuts at home

Przepis na pączki- Recipe for doughnuts

Mąka, masło, mleko, cukier- Flour, butter, milk, sugar

Czy lubicie pączki?- Do you like doughnuts?

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about Co ludzie robią w Walentynki?( What are people doing on Valentine's Day?).

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 10% Discount.

All Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Co ludzie robią w Walentynki?- What are people doing on Valentine's Day?

Oni są w restauracji, jedzą dobrą kolację- They are in the restaurant, they eat a tasty supper

Piją dobre wino, mówią miłe słowa- They drink good wine, say kind words

Oni będą robić zakupy- They will be shopping

Oni zwiedzają miasto- They are sightseeing the city

Możemy iść do kina, możemy zostać w domu- We can go to the cinema, we can stay home

Oni są w Paryżu- They are in Paris

Czy zostaniesz moją żoną?- Will you marry me?

Zaręczyny w Paryżu- Engagement in Paris

Oni spędzają czas w naturze- They spend time in nature

Przytulają się i oglądają zachód słońca- They hug and watch the sunset

Każdego roku chciałbym robić coś innego- Every year I would like to do something different

Ugotowałbym romantyczną kolację- I would cook a romantic dinner

Oni są w restauracji, jedzą dobrą kolację- They are in the restaurant, they eat a tasty supper

Piją dobre wino, mówią miłe słowa- They drink good wine, say kind words

Oni będą robić zakupy- They will be shopping

Oni zwiedzają miasto- They are sightseeing the city

Możemy iść do kina, możemy zostać w domu- We can go to the cinema, we can stay home

Oni są w Paryżu- They are in Paris

Czy zostaniesz moją żoną?- Will you marry me?

Zaręczyny w Paryżu- Engagement in Paris

Oni spędzają czas w naturze- They spend time in nature

Przytulają się i oglądają zachód słońca- They hug and watch the sunset

Każdego roku chciałbym robić coś innego- Every year I would like to do something different

Ugotowałbym romantyczną kolację- I would cook a romantic dinner

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about Symbole Walentynek - Valentine's Day symbols.

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 10% Discount.

All Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Walentynki- Valentine's Day

Dzień zakochanych- Valentine's Day

Symbole Walentynek- Valentine's Day symbols

Serce- Heart

Czekoladki- Chocolates

List miłosny- Love letter

Strzała Amora- Cupid's arrow

Czerwona róża- Red rose

Romantyczna kolacja- Romantic dinner

Wyznanie miłości- Declaration of love

Kochać- To love

Kogo kochasz?- Who do you love?

Kocham mojego męża- I love my husband

Kocham moją żonę- I love my wife

Być zakochanym w- To be in love with

Jestem zakochana w moim chłopaku- I am in love with my boyfriend

Jestem zakochany w mojej dziewczynie- I am in love with my girlfriend

Czy Ty jesteś zakochany?- Are you in love?

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about Stolik i Stolek (Table & Stool).

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 10% Discount.

All Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Stolik, stołek- Table, stool

Stolik jest to mały stół- A table is a small table

Stołek to coś na czymś siedzimy- A stool is something we sit on

To jest stylowy stolik- This is a stylish table

Kupiłem sobie ten stolik rok temu- I bought this table a year ago

Nie lubię tego stolika bo jest za mały- I don't like this table because it's too small

Za tym stolikiem stoi lampa- Behind this table there is a lamp

Książka leży na stoliku- The book is on the table

Kawa stoi na stoliku- The coffee is on the table

Najczęściej stołek jest w kuchni- Most often, the stool is in the kitchen

To jest mały stołek kuchenny- This is a small kitchen stool

Mam duży i wygodny stołek w kuchni- I have a big and comfortable stool in the kitchen

Pod stołkiem leży kot- There is a cat under the stool

Ja siedzę na stołku- I am sitting on a stool

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about What to do with Clothes.

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 10% Discount.

All Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Ubrania- Clothes

Nosić- To wear

Ja lubię nosić kolorowe sukienki w kwiatki- I like to wear colorful floral dresses

Kolorowe bluzki- Colorful blouses

Co lubisz nosić?- What do you like to wear?

Lubię nosić elegancką koszulę- I like to wear an elegant shirt

Co nosisz zimą?- What do you wear in winter?

Ja zimą noszę ciepłą kurtkę, szalik, rękawiczki- In winter I wear a warm jacket, scarf, gloves

Ocieplane buty- Warm shoes

Zakładać kurtkę, buty- Wear a jacket, shoes

Czapka z daszkiem- Cap

Mieć na sobie- Wear

Dzisiaj mam na sobie szare skarpetki- Today I am wearing gray socks

Dzisiaj mam na sobie koszulę w serduszka- Today I am wearing a shirt with hearts

Zdejmuję ubranie- I'm taking off my clothes

Rozbierać się- Undress

Ubierać się- Dress

Rano budzimy się, wstajemy i ubieramy się- In the morning we wake up, get up and dress

Ubrania zimowe, wiosenne, letnie, jesienne- Winter, spring, summer and autumn clothes

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about byc moza i Moza byc.

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 10% Discount.

All Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Być może- Perhaps

Wygląda na to, że- It seems that

Prawdopodobnie- Probably

Możliwe, że- Possible that

Może- Maybe

Chyba- I guess

Czy zjesz zupę pomidorową?- Will you eat tomato soup?

Możliwe, że tak- Maybe yes

Co będziesz robił w weekend?- What are you doing at the weekend?

Być może pojadę w góry- Perhaps I will go to the mountains

Być może pójdę na spacer do parku- Perhaps I will go for a walk in the park

Być może kupię pizze mrożoną- Perhaps I will buy a frozen pizza

Może być- Can be

Fajny- Cool

Właściwy- Appropriate

Dobry- Good

Akceptowalny- Acceptable

Podoba Ci się ten długopis? Może być - Do you like this pen? Can be

Podobał Ci się ten film? Może być- Did you like this movie? Can be

Podoba Ci się mój samochód? Może być- Do you like my car? Can be

Być może jutro poczuję się lepiej- Maybe tomorrow I'll feel better

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about Liczba mnoga - Plural.

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 10% Discount.

All Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Liczba mnoga- Plural

Jedna kawa, dwie kawy- One coffee, two coffees

Jedna herbata, dwie herbaty- One tea, two teas

Jeden pies, dwa psy- One dog, two dogs

Jeden kot, dwa koty- One cat, two cats

Jeden komputer, dwa komputery- One computer, two computers

Jeden rok, dwa lata- One year, two years

Jeden tydzień, dwa tygodnie- One week, two weeks

Jeden człowiek, ludzie- One man, people

Jeden brat, bracia- One brother, brothers

Dziecko, dzieci- Child, children

Ręka, dwie ręce- A hand, two hands

Jedno imię, dwa imiona- One name, two names

Jedno zwierzę, zwierzęta- One animal, animals

To był dobry rok- It was a good year

Lata mijają szybko- The years go by quickly

Trzy tygodnie temu byłam u rodziców- Three weeks ago I was at my parents

Jaka mają na imię twoi bracia?- What are your brothers' names?

Jak mają na imię twoje dzieci?- What are your children's names?

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about Rzeczy, które są w biurze - Things that are in the office.

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 10% Discount.

All Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Rzeczy, które są w biurze- Things that are in the office

Pieczątka- Stamp

Wygodny fotel obrotowy- Comfortable swivel chair

Drukarka- Printer

Drukować ważne dokumenty- Print important documents

Segregator- Binder

W segregatorze trzymamy ważne dokumenty- We keep important documents in a binder

Dziurkacz- Punch

Koszulka- Plastic folder

Zszywacz- Stapler

Nożyczki- Scissors

Spinacz- Clip

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about Poczta - Post Office .

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 10% Discount.

All Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Poczta- Post Office

Poczta elektroniczna- E-mail

Co mówimy na poczcie?- What do we say in the post office?

Gdzie jest najbliższa skrzynka pocztowa?- Where is the nearest mailbox?

Czy wrzucasz listy do skrzynki pocztowej?- Do you put letters in the mailbox?

Chciałbym wysłać ten list- I would like to send this letter

List polecony- Registered letter

Chciałabym wysłać list priorytetem albo pocztą lotniczą - I'd like to send a letter by priority or by airmail

Ile kosztuje paczka?- How much does the parcel cost?

Musimy kupić znaczek na list - We need to buy a stamp on the letter

Musimy kupić kopertę- We need to buy an envelope

Poproszę znaczek i kopertę- I would like a stamp and an envelope

Nadać paczkę- Send a parcel

Odebrać przesyłkę- Receive a parcel

Opłacić rachunek- Pay the bill

Chciałbym wysłać list priorytetem do Irlandii- I would like to send a priority letter to Ireland

Czy ma Pani kopertę bąbelkową?- Do you have a bubble envelope?

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about Dzikie zwierzęta - Wild animals .

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 10% Discount.

All Social Media & Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Dalekie podróże- Long journeys

Dzikie zwierzęta- Wild animals

Żyrafa ma bardzo długą szyję- The giraffe has a very long neck

Słoń ma bardzo długą trąbę- The elephant has a very long trunk

Małpa- Monkey

Krokodyl żyje w rzece- The crocodile lives in the river

Zebra- Zebra

Lew, król wszystkich zwierząt- The lion, king of all animals

Hiena- Hyena

Tygrys- Tiger

Nosorożec- Rhinoceros

Hipopotam- Hippo

Niedźwiedź- Bear

Antylopa- Antelope

Bawół- Buffalo

Które zwierzę jest twoje ulubione?- Which animal is your favorite?

Najbardziej lubię żyrafę- I like the giraffe the most

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

https://bio.link/podcaster

Please Share with your friends / Subscribe / Comment and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about Jak się czujesz? - How do you feel? .

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 10% Discount.

All Social Media https://linktr.ee/learnpolish

Donations https://linktr.ee/roycoughlan

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Jak się czujesz?- How do you feel?

Jak się masz?- How are you?

Czuję się szczęśliwy- I feel happy

Czuję się wesoły i radosny- I feel happy and joyful

Czuję się zadowolony- I feel pleased

Czuję się wspaniale- I feel great

Czuję się przygnębiony- I feel depressed

Czuję się smutny- I feel sad

Czuję się zdołowany- I feel down

Czuję się nieszczęśliwy- I feel unhappy

Czuję się pełen energii- I feel full of energy

Czuję się zainspirowany- I feel inspired

Czuję się ciekawy, kreatywny- I feel curious, creative

Czuję się skupiony- I feel focused

Czuję się zły, zdenerwowany- I feel angry, upset

Czuję się rozdrażniony- I feel annoyed

Czuję się wściekły- I feel furious

Czuję się sfrustrowany- I feel frustrated

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

https://bio.link/podcaster

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about My Strong & Weak Sides.

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 10% Discount.

All Social Media https://linktr.ee/learnpolish

Donations https://linktr.ee/roycoughlan

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Rozmowa kwalifikacyjna- Interview

Mocne strony pracownika- Employee strengths

Pracodawca to osoba, która daje pracę- An employer is a person who gives a job

Kreatywność- Creativity

Punktualność, być zawsze na czas- Punctuality, always be on time

Odporność na stres- Resistance to stress

Komunikatywność- Communicativeness

Ty jesteś komunikatywną osobą- You are a communicative person

Dobra organizacja pracy- Good work organization

Umiejętność rozwiązywania problemów- Ability to solve problems

Słabe strony pracownika- Employee weaknesses

Emocjonalność- Emotionality

Nieznajomość języka obcego- Not knowing a foreign language

Niechęć do wystąpień publicznych- Reluctance to speak in public

Brak prawa jazdy- No driving license

Nieśmiałość- Shyness

Jestem ambitny- I am ambitious

Jestem punktualny- I'm punctual

Jestem pracoholikiem- I am a workaholic

Nie lubię papierkowej roboty- I don't like paperwork

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about More Polish Idioms - Polskie idiomy.

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 10% Discount.

All Social Media https://linktr.ee/learnpolish

Donations https://linktr.ee/roycoughlan

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Polskie idiomy - Polish idioms

Kobieta ma bardzo dużo pracy- The woman has a lot of work

Mieć ręce pełne roboty- To have my hands full

Mam dużo pracy- I have a lot of work

Papierkowa robota- Paperwork

Musimy czytać i wypełniać dokumenty- We need to read and fill out documents

Lubisz papierkową robotę?- Do you like paperwork?

Papierkowa robota jest w urzędzie- Paperwork is in the office

Załatwić coś od ręki- Get something right now

Załatwić coś od razu- Arrange something right away

Nie musiał czekać, załatwiłeś od ręki- He didn't have to wait, you got it right away

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about Martwić się i Narzekać - To Worry & Complain.

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 10% Discount.

All Social Media https://linktr.ee/learnpolish

Donations https://linktr.ee/roycoughlan

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Martwić się- To worry

Narzekać- To complain

Głowa do góry- Head's up

Nie martw się- Do not worry

Nie narzekaj- Do not complain

Czy Ty się często martwisz?- Do you often worry?

Ludzie stresują się, narzekają- People get stressed, they complain

Martwię się, że nie znajdę pracy- I'm worried that I won't find a job

Martwię się o moją przyszłość- I'm worried about my future

Kobiety częściej narzekają- Women complain more often

Mój mąż ciągle narzeka- My husband still complains

Boli mnie głowa, boli mnie ząb- My head hurts, my tooth hurts

Jest brzydka pogoda- It's bad weather

Szukać rozwiązania- Look for a solution

Czy Polacy narzekają?- Do Poles complain?

Jest taki stereotyp, że Polacy narzekają- There is a stereotype that Poles complain

Ludzie narzekają na brak pracy, partnera, miłości- People complain about the lack of a job, partner, love

Ludzie narzekają na niegrzeczne dzieci- People complain about naughty kids

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about Ferie zimowe - Winter Holiday.

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 10% Discount.

All Social Media https://linktr.ee/learnpolish

Donations https://linktr.ee/roycoughlan

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Ferie zimowe- Winter Holiday

Możemy jechać w góry- We can go to the mountains

To są piękne góry- These are beautiful mountains

Jadę w góry- I'm going to the mountains

Jestem w górach- I'm in the mountains

Piesze wędrówki- Hiking

Dziesięć kilometrów pieszo- Ten kilometers on foot

Buty górskie- Mountain boots

Plecak- Rucksack

W plecaku mamy termos z gorącą herbatą- In the rucksack we have a thermos with hot tea

Wspinać się- Climb

Wędrować, spacerować po górach- To hike, walk in the mountains

Jeździć na nartach- Skiing

Jeździć na snowboardzie- Snowboarding

Podziwiać piękne widoki- Admire the beautiful views

Zdobywać szczyty górskie- To climb mountain peaks

Najwyższy szczyt górski w Polsce to Rysy- The highest mountain peak in Poland is Rysy

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about New Year's resolutions - Postanowienia noworoczne.

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 10% Discount.

All Social Media https://linktr.ee/learnpolish

Donations https://linktr.ee/roycoughlan

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Postanowienia noworoczne- New Year's resolutions

Myśl roku- Thought of the year

Nie kontroluj nikogo, tylko siebie- Control no one but yourself

Bądź zmianą, którą chcesz widzieć w świecie- Be the change you want to see in the world

Zacznę pracować, studiować- I will start working, studying

Zacznę pisać kolejne książki- I will start writing more books

Przestanę stresować się- I will stop stressing

Przestanę pić alkohol i palić- I will stop drinking alcohol and smoking

Odwiedzę nowe miejsca- I will visit new places

Odwiedzę Paryż- I will visit Paris

Nauczę się nowych słów- I will learn new words

Nauczę się pływać, śpiewać- I will learn to swim, sing

Obejrzę nowy film- I will watch a new movie

Przeczytam sto książek- I will read a hundred books

Zrobię remont w domu- I will do a renovation at home

Zmienię styl życia- I'll change my lifestyle

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this Special 200th episode we talk about Happy New Year - Szczęśliwego Nowego Roku.

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 10% Discount.

All Social Media https://linktr.ee/learnpolish

Donations https://linktr.ee/roycoughlan

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Nowy Rok- New Year

Nowy Rok, nowe nadzieje- New Year, new hopes

Życzenia na Nowy Rok- Wishes for the New Year

Impreza sylwestrowa- New Year's Eve party

Sylwester to impreza noworoczna- New Year's Eve is a New Year's party

Dokąd idziesz na Sylwestra?- Where are you going on New Year's Eve?

Biała sala (sylwester w domu)- White hall (New Year's Eve at home)

Życzymy aby Nowy Rok był szczęśliwy- We wish the New Year to be happy

Szczęśliwego Nowego Roku- Happy New Year

Życzę Ci żeby Nowy Rok był pełen miłości- I wish you a New Year full of love

Dużo zdrowia, miłości- Lots of health, love

Nie będę czekać do północy- I won't wait until midnight

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this Special 200th episode we talk about and sign Silent Night - Cicha noc.

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 10% Discount.

All Social Media https://linktr.ee/learnpolish

Donations https://linktr.ee/roycoughlan

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Cicha noc, święta noc,

Pokój niesie ludziom wszem,

A u żłóbka Matka Święta

Czuwa sama uśmiechnięta

Nad dzieciątka snem ,

Nad dzieciątka snem.

Cicha noc, święta noc,

Pastuszkowie od swych trzód Biegną wielce zadziwieni Za anielskim głosem pieni Gdzie się spełnił cud,

Gdzie się spełnił cud.

Cicha noc, święta noc ,

Narodzony Boży Syn Pan Wielkiego majestatu Niesie dziś całemu światu Odkupienie win,

Odkupienie win

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about Dzielić się opłatkiem - Share wafer.

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 10% Discount.

All Social Media https://linktr.ee/learnpolish

Donations https://linktr.ee/roycoughlan

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Dzielić się opłatkiem- Share wafer

Co to jest opłatek?- What is a wafer?

Biała mąka- White flour

Woda- Water

Każdy ma mały kawałek opłatka- Everyone has a little piece of wafer

Składamy życzenia- We make wishes

Dużo zdrowia, szczęścia- Lots of health, happiness

Opłatek to symbol przebaczenia- The wafer is a symbol of forgiveness

Cała złość znika- All the anger disappears

Zdrowych i spokojnych Świąt Bożego Narodzenia- Healthy and peaceful Christmas

Kochaj siebie- Love yourself

Doceniać to co mamy- To appreciate what we have

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about Kalendarzowa zima- Winter Calendar.

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 10% Discount.

All Social Media https://linktr.ee/learnpolish

Donations https://linktr.ee/roycoughlan

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Kalendarzowa zima- Calendar winter

Pierwszy dzień zimy- The first day of winter

Nowa pora roku- New season

Symbole związane z zimą- Symbols related to winter

Boże Narodzenie- Christmas

Śnieg - Snow

Narty- Skis

Możemy jeździć na sankach- We can go sledging

Możemy lepić bałwana- We can make a snowman

Bałwan ma nos z marchewki- The snowman has a carrot nose

Możemy jeździć na łyżwach- We can skate

Czapka, rękawiczki, ciepła kurtka- Hat, gloves, warm jacket

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about Twelve dishes for Christmas Eve - Dwanaście potraw wigilijnych.

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 10% Discount.

All Social Media https://linktr.ee/learnpolish

Donations https://linktr.ee/roycoughlan

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Kiedy zaczynamy kolację wigilijną?- When do we start the Christmas Eve dinner?

Jedzenie- Food

W wigilię jest post- On Christmas Eve there is a post

Polak głodny, Polak zły- Hungry Pole, Angry Pole

Dwanaście potraw wigilijnych- Twelve dishes for Christmas Eve

Barszcz czerwony z uszkami- Beetroot soup with dumplings

Zupa grzybowa- Mushroom soup

Karp smażony- Fried carp

Krokiety z kapustą i grzybami- Croquettes with cabbage and mushrooms

Śledzie- Herring

Łazanki z kapustą i grzybami- Noodles with cabbage and mushrooms

Pierogi z kapustą i grzybami- Dumplings with cabbage and mushrooms

Słodkie ciasta- Sweet cakes

Piernik- Gingerbread

Ciasto marchewkowe- Carrot cake

Makowiec- Poppy seed cake

Kompot z suszonych owoców- Dried fruit compote

Sernik- Cheesecake

Sałatka jarzynowa- Vegetable Salad

Różne sałatki- Various salads

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about Wigilia- Christmas Eve.

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 10% Discount.

All Social Media https://linktr.ee/learnpolish

Donations https://linktr.ee/roycoughlan

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Wigilia- Christmas Eve

Wigilia jest 24 grudnia- Christmas Eve is December 24th

Na wigilii spotykamy się z rodziną- On Christmas Eve we meet with the family

Polskie tradycje- Polish traditions

Polacy szykują kolację wigilijną- Poles are preparing a Christmas Eve dinner

Spotykają się przy wigilijnym stole- They meet at the Christmas Eve table

Czekać na pierwszą gwiazdkę- Wait for the first star

Kiedy pierwsza gwiazda jest na niebie możemy zaczynać - When the first star is in the sky we can start

Polacy dzielą się opłatkiem- Poles share a wafer

Polacy składają sobie życzenia- Poles wish each other

Składać życzenia- Make wishes

Polacy idą do kościoła o północy- Poles go to church at midnight

Specjalna msza pasterka- A special midnight Mass

Pod choinką są prezenty- There are gifts under the Christmas tree

Święty Mikołaj przynosi prezenty pod choinkę- Santa Claus brings gifts under the Christmas tree

Książka lub elegancki długopis- Book or elegant pen

Jakich prezentów nie lubisz dostawać?- What kind of gifts you do not like receiving?

Krem po goleniu- Aftershave cream

Co chcielibyście dostać pod choinkę?- What would you like to get for the Christmas tree?

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about Surówki i sałatki- Salad and salad.

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 10% Discount.

All Social Media https://linktr.ee/learnpolish

Donations https://linktr.ee/roycoughlan

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Surówki i sałatki- Salad and salad

Jaka jest różnica między surówką i sałatką?- What is the difference between “Surówka” and “Sałatka”?

Surówka jest zrobiona z surowych, świeżych warzyw- “Surówka” is made of raw, fresh vegetables

Surówka z marchewki- Carrot salad

Często robię surówkę z kapusty- I often make cabbage salad

Nie lubię surówki- I don't like salad

Jem ziemniaki ze surówką- I eat potatoes with salad

W surówce jest cebula- There is onion in the salad

Sałatka ma gotowane warzywa- The salad has boiled vegetables

To jest sałatka jarzynowa- This is a vegetable salad

Często robię sałatkę grecką- I often make Greek salad

Nie wyrzucaj tej sałatki- Don't throw that salad away

Zjem kanapkę ze sałatką- I will eat a salad sandwich

Lubię ser i jajko w sałatce- I like cheese and egg in a salad

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about Mikołajki- Saint Nicholas' Day.

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 10% Discount.

All Social Media https://linktr.ee/learnpolish

Donations https://linktr.ee/roycoughlan

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Mikołajki- Saint Nicholas' Day

Imieniny Mikołaja- Nicholas' name day

Co robimy w Mikołajki?- What do we do in Saint Nicholas’ Day?

Kupujemy dzieciom prezenty- We buy gifts for children

Polacy ubierają choinkę- Poles decorate the Christmas tree

Na choince wieszają bombki, ozdoby świąteczne- They hang baubles and Christmas decorations on the Christmas tree

Wigilia- Christmas Eve

Renifer- Reindeer

Ulubiony renifer to Rudolf- Favorite reindeer is Rudolf

Pomocnicy- Helpers

Elfy- Elves

Napisać list do Świętego Mikołaja- Write a letter to Santa Claus

Czy byłeś grzeczny w tym roku?- Have you been polite this year?

Niegrzeczne dziecko dostanie rózgę- A naughty child will get a stick

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about Co to jest włoszczyzna? - What is Włoszczyzna?.

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 10% Discount.

All Social Media https://linktr.ee/learnpolish

Donations https://linktr.ee/roycoughlan

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Co to jest włoszczyzna?- What is „Włoszczyzna”?

Włoszczyzna są to warzywa- Włoszczyzna is soup vegetables

Uniwersalny wywar do zup- Universal decoction for soups

Wywar to woda z warzyw- The decoction is water from vegetables

Gotujemy cebulę, seler, por, natkę pietruszki, marchewkę- We boil the onion, celery, leek, parsley, carrot

Bulion w kostce- Diced broth

Kapusta włoska- Savoy cabbage

Królowa Bona przywiozła do Polski włoszczyznę z Włoch- Queen Bona brought to Poland soup vegetables from Italy

Włoszczyzna jest trochę droga- Soup vegetables are a bit expensive

Za pięć złotych można zrobić cały garnek zupy- For five zlotys you can make a whole pot of soup

Jaka jest Twoja ulubiona zupa?- What is your favorite soup?

Rosół- Chicken soup

Zupa z imbirem- Ginger soup

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about Widziec or Wiedziec to See or to Know.

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 10% Discount.

All Social Media https://linktr.ee/learnpolish

Donations https://linktr.ee/roycoughlan

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Widzieć- To see

Wiedzieć- To know

Ja widzę- I see

Ty widzisz- You see

Ona, ona, ono widzi- She, he, it see

My widzimy- We see

Wy widzicie- You see

Oni, one widzą- They see

Ja widzę komputer- I see a computer

Ja widzę lampę- I see a lamp

Ja widzę, że Kamila jest w innym pokoju- I see that Kamila is in a different room

Ja wiem- I know

Ty wiesz- You know

On, ona, ono wie- He, she, it knows

My wiemy- We know

Wy wiecie- You know

Oni, one wiedzą- They know

Wiem ile masz lat- I know how old are you

Wiem, że życie będzie dobre- I know that life will be good

Wiem, gdzie mieszkasz- I know where do you live

Wiem jak się nazywasz- I know what is your surname

Wiem kiedy mamy lekcję- I know when we have a lesson

Znam Roya, znam Daniela- I know Roy, I know Daniel

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about Dyscypliny sportowe - Sport disciplines.

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 10% Discount.

All Social Media https://linktr.ee/learnpolish

Donations https://linktr.ee/roycoughlan

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Nie ma aktywności, nie ma sportu- There is no activity, no sport

Dyscypliny sportowe- Sport disciplines

Bagażnik na rower- Bicycle rack

Czy można grać teraz w tenisa?- Can you play tennis now?

Można grać w tenisa w hali- You can play tennis in the hall

Gdzie można grać w piłkę nożną?- Where can you play football?

Bieganie w parku- Running in the park

Chodzić na siłownie- Go to the gym

Czy biegasz czasami?- Do you run sometimes?

Golf jest bardzo popularny w Irlandii- Golf is very popular in Ireland

Od piętnastu lat nie grałem w piłkę nożną- I haven't played football for fifteen years

Czy chodzisz na basen?- Do you go to the swimming pool?

Sauna- Sauna

Uprawiasz siatkówkę, koszykówkę?- Do you play volleyball or basketball?

Bardzo lubiłam grać w siatkówkę i koszykówkę- I really liked playing volleyball and basketball

Polecam bieganie, pływanie, jogę w domu- I recommend jogging, swimming, yoga at home

Bardzo dużo ludzi morsuje- A lot of people winter swim

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about Ciastko, Ciasto - Cookie, Cake.

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 10% Discount.

All Social Media https://linktr.ee/learnpolish

Donations https://linktr.ee/roycoughlan

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Czy pijesz na śniadanie kawę czy herbatę?- Do you have coffee or tea for breakfast?

Czy lubisz jeść do kawy ciastko?- Do you like eating cookie with your coffee?

Ciastko, ciasto- Cookie, cake

Ciasto czekoladowe- Chocolate cake

Sernik- Cheesecake

Szarlotka- Apple pie

Ciasto z sosem malinowym- Raspberry sauce cake

To jest ciasto jabłkowe- This is apple pie

Jem pyszne ciasto- I eat a delicious cake

Nie kupuję ciasta- I don't buy a cake

A może kawę z ciastem?- Or maybe a coffee with cake?

Myślę o cieście- I think about the cake

Marzę o cieście- I dream of a cake

Dyskutujemy o cieście- We are discussing about a cake

Ciastka maślane- Butter cakes

Herbatniki- Biscuits

To ciastko jest smaczne- This cookie is tasty

Nie chcę tego ciastka- I don't want this cookie

Proszę kawę z ciastkiem- Coffee and cookie please

Myślę o ciastku- I think about the cookie

To ciastko jest bardzo duże- This cookie is very big

Nie chcę jeść tego dużego ciastka- I don't want to eat that big cookie

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about Grammar :Lubię + biernik- I like + accusative.

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 10% Discount.

All Social Media https://linktr.ee/learnpolish

Donations https://linktr.ee/roycoughlan

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Pandemia- Pandemic

Maseczka- Mask

Kiedy jest pandemia każdy musi nosić maseczkę- When there is a pandemic, everyone must wear a mask

Nosić maseczkę- Wear a mask

Maseczka chroni przed wirusami- The mask protects against viruses

Izolacja, kwarantanna- Isolation, Quarantine

Musimy zostać w domu i mamy kwarantannę- We have to stay home and we have quarantine

Wirus- Virus

Dystans społeczny- Social distance

Czekamy w kolejce i zachowujemy odległość- We wait in queue and keep our distance

Praca i nauka zdalna- Remote work and learning

Płyn do dezynfekcji- Disinfectant

Szczepienie- Vaccination

Każdy sam podejmuje decyzję- Everyone decides for himself

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about Grammar :Lubię + biernik- I like + accusative.

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 10% Discount.

All Social Media https://linktr.ee/learnpolish

Donations https://linktr.ee/roycoughlan

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Lubię + biernik- I like + accusative

Lubię chłopaka, brata, profesora, dyrektora- I like a boyfriend, brother, professor, director

Lubię przyjaciela, kurczaka, robaka- I like friend, chicken, worm

Lubię dżem, samochód- I like jam, car

Lubię mamę, kawę, siostrę- I like mum, coffee, sister

Lubię Kamilę- I like Kamila

Lubię mleko, radio, centrum- I like milk, radio, downtown

Lubię mieszkanie- I like flat

Kogo lubisz?- Who do you like?

Lubię mamę, tatę, córkę- I like mum, dad, daughter

Lubię syna, dziadka- I like son, grandfather

Lubię psa- I like dog

Lubię miód, ser, cukier- I like honey, cheese, sugar

Lubię czekoladę, zupę, kiełbasę- I like chocolate, soup, sausage

Lubię makaron, chleb, masło- I like pasta, bread, butter

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about Little Sweet Things - Małe słodkie rzeczy.

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 10% Discount.

All Social Media https://linktr.ee/learnpolish

Donations https://linktr.ee/roycoughlan

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Słodycze- Candy

Lizaki- Lollipops

Lody- Ice-cream

Jakie lody lubisz?- What kind of ice cream do you like?

Wszyscy lubią czekoladę- Everybody like chocolate

Babeczka z kremem- Cream cupcake

Cukierek owocowy- Fruit candy

Pączki- Doughnut

Piję koktajl czekoladowy- I drink a chocolate smoothie

Jakie deser chciałbyś zamówić?- What kind of dessert would you like to order?

Mam ochotę na czekoladową babeczkę- I want a chocolate cupcake

Dzisiaj mam ochotę na wszystko- Today I want everything

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about Grammar, Polskie przypadki- Polish cases

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 10% Discount.

All Social Media https://linktr.ee/learnpolish

Donations https://linktr.ee/roycoughlan

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Polskie przypadki- Polish cases

Mianownik- Denominator

Kto? Co?- Who? What?

Rzeczownik- Noun

Rodzaj męski- Masculine

Dom, pies, komputer- House, dog, computer

Lekarz, architekt, basen- Doctor, architect, swimming pool

Wyjątek- Exception

Kolega, mężczyzna, dentysta- A colleague, a man, a dentist

Rodzaj żeński- Female gender, feminine

Mama, tata, restauracja, szkoła- Mom, dad, restaurant, school

Noc, mysz, sól- Night, mouse, salt

Pani, sprzedawczyni, gospodyni- Lady, saleswoman, house wife

Rodzaj nijaki- Neutrum

Dziecko, piwo, wino, mleko- Baby, beer, wine, milk

Morze, zdjęcie, ćwiczenie- Sea, photo, exercise

Muzeum, centrum, liceum- Museum, center, high school

Kubek, kwiat- Mug, flower

Wysoki mężczyzna- Tall man

Jaka kawa?- What coffee?

Jakie mleko?- What kind of milk?

Świeże mleko- Fresh milk

To jest miły student- This is a nice student

To jest drogi zegarek- This is an expensive watch

To jest sympatyczna Pani- This is a nice lady

To jest grzeczne dziecko- This is a polite child

To jest łódzkie muzeum- This is the Lodz museum

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Co mówi sprzedawca?- What does the seller say?

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 10% Discount.

All Social Media https://linktr.ee/learnpolish

Donations https://linktr.ee/roycoughlan

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Co mówi sprzedawca?- What does the seller say?

Klient- Customer

W czym mogę pomóc?- How can I help you?

Czy w czymś mogę pomóc?- Can I help you?

Co podać?- What can I get you?

Proponuję- I suggest

Polecam- I recommend

Niestety nie ma- Unfortunatelly it is not available

Czy coś jeszcze?- Anything else?

Kartą czy gotówką?- Card or cash?

Tu jest reszta i paragon- Here's the rest and the receipt

Zapraszamy ponownie- We invite you again

Czy Ty chodzisz do małych sklepów czy do supermarketów?- Do you go to small shops or to supermarkets?

Chciałbym kupić ładne ciasto- I would like to buy a nice cake

Proponuję tort czekoladowy- I suggest a chocolate cake

Polecam tort waniliowy z owocami- I recommend the vanilla cake with fruit

Ile kosztuje?- How much is?

Czy będzie rabat?- Will there be a discount?

Płacę gotówką- I pay with cash

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Międzynarodowy Dzień Postaci z Bajek- International Cartoon Characters Day.

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 10% Discount.

All Social Media https://linktr.ee/learnpolish

Donations https://linktr.ee/roycoughlan

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Międzynarodowy Dzień Postaci z Bajek- International Cartoon Characters Day

Bajka- Cartoon

Kubuś Puchatek- Winnie the Pooh

Słodki miś- Sweet teddy bear

Bardzo lubił miód- He liked honey very much

Przyjacielem Kubusia Puchatka był Prosiaczek- Winnie the Pooh's friend was Piglet

Myszka Miki- Mickey Mouse

Smerfy- The Smurfs

Oglądałeś Smerfy?- Have you watched the Smurfs?

Polska bajka Reksio- Polish cartoon Reksio

Bajki są mądre, edukacyjne- Cartoons are wise, educational

Dlaczego lubiłeś bajki kiedy byłeś małym chłopcem?- Why did you like cartoons when you were a little boy?

Forma relaksu kiedy wracałem ze szkoły- A form of relaxation when I came back from school

Jakich bajek nie lubisz?- What kind of cartoons do you not like?

Nie lubię agresywnych bajek- I don't like aggressive cartoons

Nie lubię kiedy dużo śpiewają- I don't like when they sing a lot

Bajki dla rodziców i dla dzieci- Cartoons for parents and children

Dziecko lubi kiedy obok jest rodzina- The child likes when there is a family nearby

Jaka była Twoja ulubiona bajka z dzieciństwa?- What was your favorite childhood cartoon?

Nie miałam możliwości oglądania bajek- I did not have the opportunity to watch cartoons

Dla mnie bajki to jest fikcja- Cartoons are fiction for me

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Kanapka czy kanapa?- Sandwich or couch?.

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 10% Discount.

All Social Media https://linktr.ee/learnpolish

Donations https://linktr.ee/roycoughlan

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Kanapka czy kanapa?- Sandwich or couch?

Jadłem kanapkę na kanapie- I was eating a sandwich on the couch

To jest smaczna kanapka z serem, pomidorem i sałatą- This is a tasty sandwich with cheese, tomato and lettuce

Jem pyszną kanapkę- I eat a delicious sandwich

Nie lubię kanapki z jajkiem- I don't like egg sandwich

Nie lubię kanapki z dżemem- I don't like a jam sandwich

Chleb z cukrem- Bread with sugar

Chleb z masłem, śmietaną i cukrem- Bread with butter, cream and sugar

Mam ser na kanapce- I have cheese on a sandwich

Masz w domu kanapę?- Do you have a couch at home?

To jest zielona kanapa- This is a green couch

Lubię moją starą kanapę- I like my old couch

Nie mam nowej kanapy- I don't have a new couch

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about

Dzień Wszystkich Świętych - All Saints Day.

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 10% Discount.

All Social Media https://linktr.ee/learnpolish

Donations https://linktr.ee/roycoughlan

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

1 Listopada- 1st of November

Dzień wolny- Free day

Wszystko jest zamknięte- Everything is closed

Dzień Wszystkich Świętych-All Saints Day

Pamiętamy o naszych bliskich zmarłych-We remember our deceased relatives

Idziemy na cmentarz- We go to the cemetery

Polacy zostawiają na grobach znicz- Poles leave candles on the graves

Zapalamy znicze-We light candles

Kładziemy kwiaty na grobie-We put flowers on the grave

Wspominamy dziadka, babcię-We remember grandfather, grandmother

Spacerujemy po cmentarzu-We walk through the cemetery

Jest dużo zniczy- There are many candles

Grób-Grave

Mamy znicze i kwiaty-We have candles and flowers

Czy Twoi dziadkowie żyją?- Are your grandparents alive?

Śpieszmy się kochać ludzi tak bo szybko odchodzą- Let's hurry to love people because so quickly they leave

Czy w waszym kraju obchodzicie Dzień Wszystkich Świętych-Do you celebrate All Saints' Day in your country?

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about Head In the Sand - Chować głowę w piasek.

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 10% Discount.

All Social Media https://linktr.ee/learnpolish

Donations https://linktr.ee/roycoughlan

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Chować głowę w piasek- Hide your head in the sand

Struś- Ostrich

Udawać, że się czegoś nie wie- Pretend not to know something

Problem nie istnieje- The problem does not exist

Jest stresująca sytuacja- There is a stressful situation

Czy wolałeś udawać, że nie wiesz?- Did you prefer to pretend you didn't know?

Każdego dnia chowam głowę w piasek- Every day I hide my head in the sand

Rozwiązać problem- To solve a problem

Ludzie nie chcą znać prawdy- People don't want to know the truth

Czy wy chowacie głowę w piasek?- Do you hide your head in the sand?

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about I have a Cold - Jestem Przeziębiony

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 10% Discount.

All Social Media https://linktr.ee/learnpolish

Donations https://linktr.ee/roycoughlan

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Jestem przeziębiona- I have a cold

Jestem przeziębiony- I have a cold

Jest jesień, jest zimno- It's autumn, it's cold

Ludzie są chorzy- People are sick

Domowe sposoby na przeziębienie- Home remedies for colds

Olejek z oregano- Oregano oil

Olejek kokosowy- Coconut oil

Miód z kurkumą- Honey with turmeric

Herbata z miodem i cytryną- Tea with honey and lemon

Złote mleko z kurkumą- Golden milk with turmeric

Herbata z imbirem- Ginger tea

Goździki- Cloves

Syrop z cebuli- Onion syrup

Inhalacja- Inhalation

Ręcznik na głowie- Towel on the head

Płukanie gardła solą- Gargling with salt

Witaminy, suplementy- Vitamins, supplements

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about What Does the Waiters Say - Co mówi kelner/kelnerka?.

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 10% Discount.

All Social Media https://linktr.ee/learnpolish

Donations https://linktr.ee/roycoughlan

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Restauracja- Restaurant

Co mówi kelner/kelnerka?- What does the waiter / waitress say?

Co dla Pana, Pani?- What for you?

Co dla Państwa?- What for You?

Słucham? Co podać?- I'm listening? What can I get you?

Czym mogę służyć?- May I help you?

W czym mogę pomóc?- How can I help you?

Czy mogę przyjąć zamówienie?- May I take your order?

Czy Pan będzie jeść na miejscu czy na wynos?- Will you eat in or take away?

Czy coś do picia?- Something to drink?

Czy coś na deser?- Something for dessert?

Ja proponuję , polecam- I propose, recommend

Sugeruję szarlotkę z lodami- I suggest apple pie with ice cream

Czy coś jeszcze?- Anything else?

Czy to wszystko?- Is that all?

Smacznego- Enjoy your meal

Jestem dzisiaj bardzo głodny- I am very hungry today

Na pierwsze danie poproszę zupę pomidorową- For the first course, I would like tomato soup

Proponuję deser- I suggest a dessert

Mamy różne ciasta- We have various cakes

Poproszę czarną kawę- Black coffee, please

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about Teachers Day - Dzień Nauczyciela.

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 10% Discount.

All Social Media https://linktr.ee/learnpolish

Donations https://linktr.ee/roycoughlan

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Dzień Nauczyciela- Teacher Day

Składamy życzenia naszym nauczycielom- We wish our teachers

Wszystkiego najlepszego z okazji Dnia Nauczyciela- Best wishes on teacher's day

Spóźnione życzenia- Belated wishes

Jesteś najlepszą nauczycielką- You are the best teacher

Ten nauczyciel jest dobry- This teacher is good

Ta nauczycielka jest dobra- This teacher is good

Mam świetnego nauczyciela- I have a great teacher

Nie znam tego wysokiego nauczyciela- I don't know this tall teacher

Każdy student myśli o swoim nauczycielu- Each student thinks about his teacher

Rozmawiam z moją nauczycielką- I am talking to my teacher

Dzięki mojemu nauczycielowi znam polską gramatykę- Thanks to my teacher, I know Polish grammar

Dzięki mojej nauczycielce znam język polski- Thanks to my teacher, I know Polish

Dzięki mojej nauczycielce języka polskiego mówię lepiej po polsku każdego dnia- Thanks to my Polish teacher, I speak Polish better every day

Jak miał na imię Twój ulubiony nauczyciel?- What was the name of your favorite teacher?

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about Polskie Zupy- Polish Soups.

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 10% Discount.

All Social Media https://linktr.ee/learnpolish

Donations https://linktr.ee/roycoughlan

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Polskie zupy- Polish soups

Zupa to pierwsze danie-The soup is the first course (dish)

Zupa pomidorowa- Tomato soup

Zupa ogórkowa- Cucumber soup

Barszcz czerwony- Red borscht

Zupa cebulowa z chlebem- Onion soup with bread

Zupa fasolowa- Bean soup

Kapuśniak- Cabbage soup

Zupa dyniowa-Pumpkin soup

Zupa kalafiorowa- Cauliflower soup

Zupa pieczarkowa- Champignon mushroom soup

Zupa grzybowa- Mushroom soup

Na obiad zjadłabym kapuśniak albo barszcz czerwony- I would eat cabbage soup or red borscht for dinner

Na którą zupę macie ochotę?- Which soup would you like?

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about Sprzęty Domowe- Household Appliances.

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 10% Discount.

All Social Media https://linktr.ee/learnpolish

Donations https://linktr.ee/roycoughlan

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Sprzęty domowe- Household appliances

Biały elektryczny czajnik- White electric kettle

Czajnik na gaz- Gas kettle

Czajnik służy do robienia herbaty- The kettle is used to make tea

Czajnik jest nowoczesny i ma różne opcje- The kettle is modern and has various options

Kuchenka- Oven

Kuchenka służy do gotowania- The oven is used for cooking

Kuchenka indukcyjna lub gazowa- Induction cooker or gas burner

Cztery palniki na kuchence- Four burners on the oven

Dwa palniki gazowe- Two gas burners

Żelazko służy do prasowania- The iron is used for ironing

Para- Steam

Odkurzacz służy do odkurzania- The vacuum cleaner is used to vacuum

Maszynka do golenia- Razor

Czy używasz depilatora?- Are you using an epilator?

Żyletka metalowa- Metal razor

Kuchenka mikrofalowa służy do podgrzewania jedzenia- The microwave oven is used to heat food

To jest niezdrowe- This is unhealthy

Pralka służy do prania ubrań- The washing machine is used to wash clothes

Proszek do prania- Washing powder

Ekologiczne orzechy- Organic nuts

Ubranie było brudne- The clothes were dirty

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about I Love Pumpkin (Kocham Dynię).

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 10% Discount.

All Social Media https://linktr.ee/learnpolish

Donations https://linktr.ee/roycoughlan

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Jakie warzywa są popularne jesienią?- What vegetables are popular in the autumn?

To jest dynia- This is a pumpkin

Zupa dyniowa na obiad- Pumpkin soup for dinner

Krem z dyni- Pumpkin cream

Łyżka śmietany- A tablespoon of cream

Słodycze- Candy

Możemy upiec ciasto dyniowe- We can bake a pumpkin pie

Naleśniki dyniowe- Pumpkin pancakes

Przepisy po polsku- Recipes in Polish

Dzieci przebierają się- Children get change

Twarz z dyni- Pumpkin face

Ciekawa historia- An interesting story

Czy lubicie dynie?- Do you like pumpkins?

Macie swój przepis na danie z dyni?- Do you have your own pumpkin recipe?

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about thelove of salad (Kocham sałatkę).

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 10% Discount.

All Social Media https://linktr.ee/learnpolish

Donations https://linktr.ee/roycoughlan

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Polska złota jesień- Polish golden autumn

Pójść do lasu, do parku- Go to the forest, to the park

Śniadanie w niedzielę- Breakfast on Sunday

Sałatki- Salads

Z czym jest ta sałatka?- What is this salad with?

Jaka jest Twoja ulubiona sałatka?- What's your favorite salad?

Z pomidorami, z cebulą, ze sałatą- With tomatoes, onions, with lettuce

Z zielonymi oliwkami- With green olives

Dobra oliwa z oliwek- Good olive oil

Sałatka z czerwoną kapustą, marchewką, cukinią- Salad with red cabbage, carrots, zucchini

Granat ma bardzo dużo witaminy C- Pomegranate has a lot of vitamin C

Sałatka z kiwi, borówkami, winogronem, pomarańczą- Kiwi, blueberry, grape and orange salad

Sałatka jarzynowa- Vegetable Salad

Zielony groszek, marchewka, ziemniaki, majonez, ogórek- Green peas, carrots, potatoes, mayonnaise, cucumber

Z ziołami- With herbs

Sałatka grecka- Greek salad

Z czarnymi oliwkami, pomidorami, ze sałatą- With black olives, tomatoes, with lettuce

Z serem feta- With feta cheese

Którą sałatkę chciałbyś zamówić na niedzielne śniadanie?- Which salad would you like to order for Sunday breakfast?

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about the symbols of Aumumn (Symbole jesieni).

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 10% Discount.

All Social Media https://linktr.ee/learnpolish

Donations https://linktr.ee/roycoughlan

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Symbole jesieni- Autumn symbols

Jesień to piękna pora roku- Autumn is a beautiful time of the year (season)

Piękne kolorowe jesienne liście- Beautiful colorful autumn leaves

Spadające liście- Falling leaves

Jesienią jest zimno- It's cold in the autumn

Jest brzydka pogoda- It's bad weather

Ludzie zostają w domu pod kocykiem- People stay home under a blanket

Jesienią pijemy gorącą herbatę lub gorące wino- In autumn, we drink hot tea or hot wine

Możemy używać naturalnych przypraw- We can use natural spices

Imbir, kurkuma, cynamon- Ginger, turmeric, cinnamon

Piękna wiewiórka- Beautiful squirrel

Wiewiórka jest zawsze wesoła- The squirrel is always happy

Wiewiórka robi zapasy na zimę- The squirrel stocks up for the winter

Wiewiórka skacze, szuka jedzenia- The squirrel is jumping, looking for food

Jesienią pada deszcz i na ulicy są kałuże- In autumn it rains and there are puddles on the street

Gumowe buty nazywają się kalosze- The rubber boots are called galoshes

Skakać do kałuży- Jump into a puddle

Zbierać kolorowe liście i robić piękne jesienne bukiety- Collect colorful leaves and make beautiful autumn bouquets

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about the Rat Race (Wyścig szczurów).

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 10% Discount.

All Social Media https://linktr.ee/learnpolish

Donations https://linktr.ee/roycoughlan

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Wyścig szczurów- Rat race

Ludzie pracują w firmie- People work in the company

Ludzie nie myślą o zdrowiu i o rodzinie- People don't think about health and family

Ludzie pracują dla pieniędzy- People work for money

Rywalizacja- Competition

Konkurencja- Competition

Rywalizować- Compete

Moja firma rywalizuje z Twoją firmą- My company competes with your company

Która firma jest lepsza- Which company is better

Firmy konkurują- Companies compete

Wygrywać- To win

Kto wygrywa- Who is winning

Przegrywać- Lose

Wszyscy rywalizują- Everyone competes

Pieniądze Cię nie przytulą- Money won't hug you

Relacje międzyludzkie nie są teraz dobre- Relationships are not good now

To jest mój rywal- This is my rival

Wyścig szczurów prowadzi do kariery, popularności- Rat race leads to career, popularity

Taka osoba jest zestresowana, nie może dobrze spać- Such a person is stressed, he can not sleep well

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about welcoming October practicing to read in Polish.

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 10% Discount.

All Social Media https://linktr.ee/learnpolish

Donations https://linktr.ee/roycoughlan

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Jesień- Autumn

Cztery pory roku- Four Seasons

Wiosna, lato, jesień ,zima- Spring, Summer, Autumn, Winter

Lubisz jesień?- Do you like autumn?

Polska jesień jest bardzo piękna- Polish autumn is very beautiful

Złote liście- Golden leaves

Witaj październiku- Hello October

Lubię jesień bo jest magiczna- I like autumn because it is magical

Jesienią nie jest ani za gorąco ani za zimno- It's neither too hot nor too cold in the autumn

Uwielbiam jesienne kolory- I love autumn colours

Często wychodzę na spacer- I often go for a walk

Fotografuję kolorowe jesienne liście- I photograph colorful autumn leaves

Jesienią dzień jest krótszy- In the autumn the day is shorter

Więcej czasu spędzam w domu- I spend more time at home

Leżę pod kocem- I'm lying under the blanket

Piję gorącą herbatę z imbirem i miodem- I drink hot tea with ginger and honey

Czytam moje ulubione książki- I read my favorite books

Robię też plany na przyszłość- I also make plans for the future

Dlaczego wy lubicie jesień?- Why do you like autumn?

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about How are you? / What is wrong?

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 10% Discount.

All Social Media https://linktr.ee/learnpolish

Donations https://linktr.ee/roycoughlan

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Co Ci jest?- How are you? / What is wrong?

Jest mi gorąco- I am hot

Gorąco mi- I am hot

Jest mi ciepło- I'm warm

Ciepło mi- I'm warm

Jest mi zimno- I'm cold

Jest mi dobrze- I feel good

Jest mi źle- I feel bad

Jest mi smutno- I am sad

Jest mi wesoło-I feel happy

Chce mi się jeść- I want to eat

Chce mi się spać- I'm sleepy

Chce mi się pić- I'm thirsty

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about to be afraid.

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 10% Discount.

All Social Media https://linktr.ee/learnpolish

Donations https://linktr.ee/roycoughlan

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Strach- Fear

Zmartwienie- Worry

Wyrażanie strachu i zmartwienia- Expressing fear and worry

Boję się języka polskiego- I'm afraid of the Polish language

Boję się, że nie zdam egzaminu- I'm afraid that I won't pass the exam

Boję się, że nie będę miał pracy- I'm afraid I won't have a job

Obawiam się burzy- I'm afraid of the storm

Obawiam się ciemności- I'm afraid of the dark

Lękam się złych ludzi- I'm afraid of bad people

Lękam się ciemności- I'm afraid of the dark

Boję się o Ciebie- I'm worried about you

Boję się o moją mamę- I'm worried about my mom

Martwię się o moją przyszłość- I'm worried about my future

Nie przejmuj się, wszystko będzie dobrze- Do not worry everything will be fine

Przejmuję się sytuacją polityczną- I worry about the political situation

Przejmuję się ludźmi- I care about people

Obawiam się, że nie będę miał czasu- I'm afraid I won't have time

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about request for advice.

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 10% Discount.

All Social Media https://linktr.ee/learnpolish

Donations https://linktr.ee/roycoughlan

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Prośba o radę- Request for advice

Co byś zrobił na moim miejscu?- What would you do in my place?

Źle się czuję, co byś zrobił na moim miejscu?- I feel bad, what would you do in my place?

Co mam robić?- What should I do?

Jestem bardzo zmęczona, nie mam czasu, co mam robić?- I am very tired, I do not have time, what should I do?

Możesz mi doradzić?- Can you advise me?

Możesz mi pomóc?- Can you help me?

Nie wiem co mam robić?- I do not know what to do?

Co powinnam zrobić?- What should I do?

Chcę być szczupła, co powinnam zrobić?- I want to be slim, what should I do?

Udzielanie rady- Giving advice

Na twoim miejscu – In your place

Musisz- You must

Warto- Worth

Trzeba- It's necessary to (Have to)

Powinieneś- You should

Nie pal tyle- Do not smoke so much

Jedz więcej owoców- Eat more fruit

Odpoczywaj- Rest

Na Twoim miejscu kupiłabym nowy samochód- If I were you, I would buy a new car

Musisz kupić ekonomiczny samochód- You must buy an economical car

Warto uczyć się polskiego- It is worth to learn Polish

Trzeba uczyć się polskiego- You have to learn Polish

Powinieneś pić dużo wody- You should drink plenty of water

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about Why I like the Village.

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 10% Discount.

All Social Media https://linktr.ee/learnpolish

Donations https://linktr.ee/roycoughlan

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Wieś- Village

Czy Ty mieszkasz w mieście, czy mieszkasz na wsi?- Do you live in the city or in the countryside?

Mieszkam blisko wsi- I live close to the village

Wieś jest lepsza- The countryside is better

Klasyczna polska wieś- Classic Polish countryside

Na wsi jest spokojnie- It is quiet in the countryside

Nie ma tramwajów, autobusów- There are no trams, buses

Na wsi jest cicho- In the countryside it is quiet

W mieście jest bardzo głośno- It's very loud in the city

Na wsi jest czyste powietrze- There is clean air in the countryside

Na wsi jest piękna przyroda- There is beautiful nature in the countryside

Piękne rośliny- Beautiful plants

Fauna i flora- Fauna and flora

Motyle- Butterflies

Na wsi jest ekologiczne jedzenie- There is ecological food in the countryside

Ludzie na wsi mają ogród- People in the countryside have a garden

Prywatne warzywa- Private vegetables

Ludzie mają krowy i świeże mleko- People have cows and fresh milk

Na wsi nie ma hałasu- There is no noise in the countryside

Na wsi nie ma dużo ludzi- There are not many people in the countryside

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about How do you feel today? (Jak się dziś czujesz?).

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 10% Discount.

All Social Media https://linktr.ee/learnpolish

Donations https://linktr.ee/roycoughlan

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Jak się dzisiaj czujesz?- How are you feeling today?

Spokojny- Calm

Zły- Angry

Śpiący- Sleepy

Szczęśliwy- Happy

Zmartwiony- Worried

Nieśmiały- Shy

Zmęczony- Tired

Zszokowany- Shocked

Dumny- Proud

Obolały- Sore

Wystraszony- Scared

Nie jestem śpiący- I'm not sleepy

Jestem spokojny- I'm calm

Jestem dumny- I'm proud

Który ząb Cię boli?- Which tooth is hurting you?

Jak się dzisiaj czujecie?- How are you today?

Dlaczego jesteś smutny?- Why are you sad?

Dlaczego jesteś nieśmiały?- Why are you shy?

Jestem zmęczony bo dużo pracuję- I am tired because I work a lot

Jestem dumny bo mój syn poszedł do szkoły- I'm proud because my son went to school

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about Is Your Head In the Clouds. Chodzić z głową w chmurach- Walk with your head in the cloud.

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 10% Discount.

All Social Media https://linktr.ee/learnpolish

Donations https://linktr.ee/roycoughlan

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Chodzić z głową w chmurach- Walk with your head in the cloud (To have your head in the Cloud)?

Osoba jest zamyślona- The person is thoughtful

Osoba jest nieobecna- Person is absent

Osoba rozmarzona- Dreamy person

Osoba roztrzepana- Distracted person

Czy Ty czasami chodzisz z głową w chmurach?- Do you sometimes walk with your head in the clouds?

Jesteśmy zakochani- We are in love

Kiedy mamy dużo planów i marzeń- When we have a lot of plans and dreams

Jestem racjonalny- I am rational

Byłem cały czas rozmarzony- I was dreaming all the time

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about How to Start Your Day (Jak rozpocząć dzień?).

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 10% Discount.

All Social Media https://linktr.ee/learnpolish

Donations https://linktr.ee/roycoughlan

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Jak dobrze zacząć dzień?- How to start the day well?

Pierwszy moment dnia jest bardzo ważny – The first moment of the day is very important

Zależy jak będzie wyglądał dalszy ciąg dnia- It depends on what the rest of the day will look like

Kobieta obudziła się- The woman woke up

Uśmiechnij się- Smile

Otwórz okno- Open the window

Wypij szklankę wody- Drink a glass of water

Poćwicz- Exercise

Pobiegaj- Run

Idź na spacer- Go for a walk

Pomedytuj- Meditate

Nie włączaj telefonu- Don't turn on the phone

Powiedz kilka miłych rzeczy- Say some nice things

Zjedz pyszne śniadanie- Eat a delicious breakfast

Nie mam zasłon- I have no curtains

Budzę się naturalnie- I wake up naturally

Rano robię plan dnia- In the morning I make a plan for the day

Wstać bardzo wcześnie- Get up very early

Czas tylko dla siebie kiedy wszyscy śpią- Time only for myself when everyone sleep

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about to be Right or In a Relationship.

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 10% Discount.

All Social Media https://linktr.ee/learnpolish

Donations https://linktr.ee/roycoughlan

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Kłótnia- Argument

Kłócić się- Argue

Nie lubię kłócić się- I don't like to argue

Racja czy relacja?- Right or relationship?

Dlaczego ludzie kłócą się?- Why do people argue?

Ludzie chcą mieć rację- People want to be right

Relacja jest ważniejsza- The relationship is more important

Mamy w sobie gniew- We have anger inside us

Kłótnie niszczą nasze relacje z innymi osobami- Quarrels damage our relationships with others

Oni czegoś chcą, mają potrzeby- They want something, they have needs

Żona chce żeby mąż posprzątał, a mąż nie chce- The wife wants her husband to clean up, and the husband does not want to

Nasze relacje są smutne- Our relationships are sad

Żeby była kłótnia muszą być dwie osoby- There must be two people to be an argument

Jedna osoba medytuje i ma akceptację dla drugiej- One person meditates and accepts the other

Kiedy ludzie się kłócą to krzyczą- When people argue they shout

Kiedy jest harmonia, serca są blisko siebie- When there is harmony, hearts are close to each other

Komunikować się bez słów- Communicate without words

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about motto of life (Życiowe motto).

Sponsor www.coolabulla.com for Websites and Animation. Use code LearnPolish for 10% Discount.

All Social Media https://linktr.ee/learnpolish

Donations https://linktr.ee/roycoughlan

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Życiowe motto- Life motto

Jakie jest Twoje motto życiowe?- What is your life motto?

Nie lubię korupcji- I don't like corruption

Nigdy się nie poddawaj- Never give up

Zawsze chcesz osiągnąć cel- You always want to achieve the goal

Jaki jest teraz Twój cel?- What's your goal now?

Czasami idziemy pod górkę- Sometimes we go up the hill

Nie mamy motywacji, determinacji- We have no motivation, no determination

Kiedy jesteś zmęczony, leżysz- When you are tired you lie

Robić krótką przerwę, żeby naładować baterie- Take a short break to recharge the batteries

Medytuj i bądź szczęśliwy- Meditate and be happy

Mamy większy dystans do myśli, do świata- We have a bigger distance to thoughts, to the world

Czujemy wewnętrzną radość- We feel inner joy

Być tu i teraz- To be here and now

Nie wybiegać w przyszłość- Not to look into the future

Jakie jest wasze motto życiowe?- What is your life motto?

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about Kartka Pocztowa (Post Cards)).

Sponsor www.coolabulla.com for Websites and Animation. Use code Polish for 10% Discount.

All Social Media https://linktr.ee/learnpolish

Donations https://linktr.ee/roycoughlan

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Pocztówka- Postcard

Jak napisać pocztówkę?- How to write a postcard

Drogi Janku- Dear Janek

Cześć Babciu- Hi Grandma

Cześć Wszystkim- Hi to all

Serdeczne pozdrowienia z wakacji- Best wishes from holidays

Słoneczne pozdrowienia z ciepłego morza- Sunny greetings from the warm sea

Deszczowe pozdrowienia z gór- Rainy greetings from the mountains

Przesyłam serdeczne pozdrowienia z- I send cordial greetings from

Podoba mi się tutaj- I like it here

Wracam w przyszłym tygodniu- I'm coming back next week

Jest ciepło- It's warm

Jest pochmurno- It's cloudy

Codziennie jest wiele rzeczy do robienia- There are many things to do every day

Jestem bardzo zajęty- I'm very busy

Doskonale się tu bawię- I have a great time here

To moje najgorsze wakacje- This is my worst vacation

A Ty jak spędzasz wakacje?- And how do you spend your holiday?

Przekaż pozdrowienia- Send greetings

Pozdrów tatę- Say hello to dad

Do zobaczenia wkrótce- See you soon

Wszystkiego dobrego- All the best

Pływam każdego dnia- I swim every day

Czytam dużo książek- I read a lot of books

Napiszcie pocztówkę- Write a postcard

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about wyas of saying Przepraszam ( I'm Sorry).

Sponsor www.coolabulla.com for Websites and Animation. Use code Polish for 10% Discount.

All Social Media https://linktr.ee/learnpolish

Donations https://linktr.ee/roycoughlan

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Przepraszam- I am sorry

Przepraszanie- Apologizing

Przepraszam bardzo- I am very sorry

Jest mi bardzo przykro- I am very sorry

Wybacz mi- Forgive me

To co zrobiłem było niemądre- What I did was silly

Wszystko to moja wina- It's all my fault

Wybacz mi proszę moją arogancję- Please forgive me my arrogance

Przyjmij moje najszczersze przeprosiny- Please accept my sincerest apologies

Nie złość się na mnie- Do not be mad at me

Teraz rozumiem, że nie powinienem tego zrobić- Now I understand that I shouldn't have done this

Zachowałem się jak głupek- I acted like a fool

Przepraszam, że Cię zawiodłem- I'm sorry to let you down

Przepraszam z całego serca- I'm sorry with all my heart

Trudno mi wyrazić jak bardzo mi przykro- It is difficult for me to express how sorry I am

Chciałabym wyrazić jak bardzo mi przykro- I would like to express how sorry I am

Nigdy nie przepraszam- I never apologize

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about Tesknie Za ( I miss).

Sponsor www.coolabulla.com for Websites and Animation. Use code Polish for 10% Discount.

All Social Media https://linktr.ee/learnpolish

Donations https://linktr.ee/roycoughlan

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Tęsknić- To miss

Tęsknię za- I miss

Za kim tęsknisz?- Who do you miss?

Tęsknię za mężem- I miss my husband

Tęsknie za domem- I miss home

Tęsknię za krajem- I miss my country

Tęsknię za psem- I miss my dog

Tęsknię za moją pracą- I miss my job

Tęsknię za dzieckiem- I miss my child

Tęsknię za moją mamą- I miss my mom

Tęsknię za moim tatą- I miss my dad

Tęsknię za Irlandią- I miss Ireland

Za czym tęsknisz?- What do you miss?

Tęsknię za przytulaniem się- I miss hugging

Tęsknię za obiadami mojej mamy- I miss my mom's dinners

Tęsknię za humorem- I miss humor

Tęsknię za światem bez pandemii- I miss a world without a pandemic

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about Znaki Zodiaku (Zodiak Signs).

Sponsor www.coolabulla.com for Websites and Animation. Use code Polish for 10% Discount.

All Social Media https://linktr.ee/learnpolish

Donations https://linktr.ee/roycoughlan

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Znaki zodiaku- Signs of the zodiac

Znam mój znak zodiaku- I know my zodiac sign

Jaki jest Twój znak zodiaku?- What is your zodiac sign?

Waga- Libra

Wodnik- Aquarius

Baran- Aries

Bliźnięta- Gemini

Byk- Taurus

Koziorożec- Capricorn

Lew- Leo

Panna- Virgo

Rak- Cancer

Ryby- Pisces

Skorpion- Scorpio

Strzelec- Sagittarius

Mój znak zodiaku to baran- My sign of zodiac is aries

Jestem wagą- I am a libra

Jestem rakiem- I am a cancer

Lubisz czytać horoskopy?- Do you like reading horoscopes?

Jaki jest skorpion?- What is a scorpion like?

Najbardziej emocjonalny i wrażliwy znak zodiaku- The most emotional and sensitive sign of the zodiac

Chętnie słucha o problemach innych ludzi- He is eager to hear about other people's problems

Sam jest zamknięty i nie mówi jakie ma problemy- He is closed and does not say what his problems are

Waga ciągle szuka, jest bardzo aktywna- Libra is constantly looking, is very active

Osoba skromna i charyzmatyczna- A modest and charismatic person

Waga umie abstrakcyjnie myśleć- Libra can think abstractly

Napiszcie swój znak zodiaku- Write your zodiac sign

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about Marriage Troubles ( Kłopoty małżeńskie).

Sposor www.coolabulla.com for Websites and Animation. Use code Polish for 10% Discount.

All Social Media https://linktr.ee/learnpolish

Donations https://linktr.ee/roycoughlan

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Kłopoty małżeńskie- Marriage troubles

Oczekiwania- Expectations

Ja chcę, żeby mój partner robił coś- I want my partner to do something

Wolna wola- Free will

Krytyka- Criticism

Ty jesteś niedobrym mężem- You are a bad husband

Trzeba w relacji patrzeć na dobre strony- You have to look at the good sides in the relationship

Pszczoła- Bee

Pszczoła leci do dobrych rzeczy- The bee flies to good things

Mucha leci do złych rzeczy- The fly flies to the bad things

Musimy w związku być jak pszczoła- We must be like a bee in a relationship

Szukać w partnerze dobrych rzeczy- Look for good things in your partner

Zmuszać- Force

Chcemy żeby partner zmienił się- We want the partner to change

Partner nie chce, żeby spotykała się z innymi ludźmi- The partner does not want her to meet other people

Musicie szukać dobrych rzeczy- You must look for the good things

Nie zmuszać- Do not force

Być tolerancyjnym- To be tolerant

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about The World in the Past, Present and Future (Świat w przeszłości, teraźniejszości i przyszłości).

All Social Media https://linktr.ee/learnpolish

Donations https://linktr.ee/roycoughlan

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Świat- World

W przeszłości- In the past

W przyszłości- In the future

Jaki był świat sto lat temu?- How was the world a hundred years ago?

Teraz są samoloty- Now there are planes

W przeszłości ludzie jeździli konno- In the past, people used to ride horses

Ludzie chodzili pieszo- People were walking

Ludzie szyli ubrania- People sewed clothes

Ludzie jedli ekologiczne jedzenie- People ate organic food

Ludzie dyskutowali przy stole- People were discussing at the table

Język francuski był popularny- The French language was popular

Ludzie podróżują samochodem, samolotem, motocyklem- People travel by car, plane, motorcycle

Jedzenie jest niezdrowe- Food is unhealthy

Ludzie pisali listy ręcznie- People wrote letters by hand

Teraz piszemy smsy- Now we write text messages

Będziemy kontaktować się telepatycznie- We will communicate telepathically

Ludzie będą się teleportować- People will teleport

Kombinezon kosmiczny- Space suit

Ludzie będą jeść małe tabletki- People will eat little pills

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about Uwaga na Konstrukcjje (Careful of the (Languages) Construction).

All Social Media + Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Mówić po polsku- To speak Polish

Mówić po angielsku- To speak English

Mówić po włosku- To speak Italian

Mówię po angielsku- I speak English

Czy mówisz po hiszpańsku?- Do you speak Spanish?

Znam polski- I know polish

Znam angielski- I know English

Jaki znasz język?- What language do you know?

Znam trochę hiszpański- I know a little Spanish

Uczę się polskiego- I'm learning Polish

Uczę się angielskiego- I'm learning English

Ja mówię po polsku, znam polski, uczę się polskiego- I speak Polish, I know Polish, I'm learning Polish

Znam polski, trochę hiszpański, każdego dnia uczę się polskiego- I know Polish, a little bit of Spanish, I learn Polish every day

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about Znaki Interpunkcyjne (Punctuation Marks).

All Social Media + Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Czy lubisz pisać teksty?- Do you like writing texts?

Wolę dzwonić- I prefer calling

Znaki interpunkcyjne- Punctuation marks

Średnik- Semicolon

Kropka- Dot

Kropkę piszemy na końcu zdania- We write a dot at the end of the sentence

Przecinek- Comma

Lubię lody, słodycze, owoce- I like ice cream, sweets, fruit

Wielokropek- Ellipsis

Refleksja- Reflection

Dwukropek- Colon

W weekend: sprzątam, gotuję- On the weekend: I clean, cook

Cudzysłów- Quote

Cytujemy czyjeś słowa- We quote someone else's words

Myślnik- Dash

Podkreślenie- Underline

Nawias- Bracket

Ukośnik- Slash

Wykrzyknik- Exclamation

Mówimy coś bardzo głośno- We say something very loud

Znak zapytania- Question mark

Co lubisz robić?- What do you like to do?

Co myślisz?- What do you think?

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about Kosmetyki (Cosmetics).

All Social Media + Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Kosmetyki- Cosmetics

Robić makijaż- To do makeup

Większość kobiety maluje się- Most women do makeup

Tusz do rzęs- Mascara

Kredka do oczu- Eyeliner

Pomadka (szminka)- Lipstick

Czerwona pomadka- Red lipstick

Cienie do powiek- Eyeshadow

Co najczęściej kobiety malują?- What do women paint most often?

Kobiety malują paznokcie- Women paint their nails

Sztuczne paznokcie- Artificial nails

Kobiety malują rzęsy i powieki- Women paint eyelashes and eyelids

Czy nastolatki powinny robić makijaż?- Should teenagers do makeup?

Kosmetyki mają chemię, są niezdrowe- Cosmetics have chemicals, they are unhealthy

Kosmetyki wegańskie- Vegan cosmetics

Wyglądasz pięknie- You look beautiful

Naturalne oleje zamiast kremu- Natural oils instead of cream

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about insects (owady).

All Social Media + Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Owad- Insect

Lubisz owady?- Do you like insects?

Motyl jest piękny- The butterfly is beautiful

Moskitiera na oknie- Mosquito net on the window

Mucha- Fly

Mucha bzyczy- The fly buzzes

Mucha denerwuje- The fly annoys

Lep na muchy- Flypaper

Komar- Mosquito

Komar lubi pić krew- The mosquito likes to drink blood

Komar kąsi- The mosquito bites

Ugryzł mnie komar- I was bitten by a mosquito

Czerwony bąbel swędzi- The red bubble itches

Drapać- Scratch

Pszczoła- Bee

Pszczoła mnie użądliła- A bee stung me

Pszczoły są bardzo pożyteczne- Bees are very useful

Niektórzy ludzie mają alergię na pszczoły- Some people are allergic to bees

Biedronka- Ladybug

Biedronka przynosi szczęście- Ladybug brings good luck

Biedroneczko leć do nieba, przynieś mi kawałek chleba- Ladybug fly to heaven, bring me a piece of bread

Biedronka to symbol szczęścia- Ladybug is a symbol of happiness

Czy w waszym domu są muchy i komary?- Are there flies and mosquitoes in your home?

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about texting abbreviations.

All Social Media + Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:'

Przyimek „po”- The preposition "po"

Po co?- For what?

Po pracy- After work

Po polsku- In Polish

Spotykamy się po pracy- We meet after work

Po obiedzie- After dinner

Jestem po śniadaniu- I'm after breakfast

Jestem po zakupach- I'm after shopping

Mówię po polsku- I speak Polish

Mówię po angielsku- I speak English

Jak to się pisze po polsku?- How is it spelled in Polish?

Po co idziesz do sklepu?- Why are you going to the shop?

Idę do sklepu po kawę- I go to the store for coffee

Idę do sklepu po lody- I go to the store for ice cream

Idę do Lidla po greckie oliwki- I'm going to Lidl for Greek olives

Spaceruję po lesie- I'm walking in the forest

Spaceruję po ulicy- I'm walking on the street

Podróżuję po Europie- I travel around Europe

Podróżuję po świecie- Travels around the world

Będę podróżował po Europie- I will travel around Europe

Napiszcie w komentarzach przykłady- Write examples in the comments

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about texting abbreviations.

All Social Media + Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:'

Lubisz pisać smsy?- Do you like writing text messages?

Wiadomość tekstowa- Text message

Wolę rozmawiać twarzą w twarz- I prefer to talk face to face

Zaraz wracam (zw)- I'll be right back

Trzymaj się- Take care

Będę potem (bpt)- I'll be then

Odpisz (odp)- Reply

Już jestem (jj)- I'm back

Pozdrawiam (pzdr)- Regards

Miłego dnia (md)- Have a nice day

Spoko (spx)- Cool

Do zobaczenia (dozo)- See you

Nara- See you

Formy skrócone- Abbreviated forms

Emotikona- Emoticon

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about why friends are important.

All Social Media + Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:'

Kim jest przyjaciel?- Who is a friend?

Dlaczego warto mieć przyjaciela?- Why is it worth having a friend?

Przyjaciel to ktoś, na kogo możemy liczyć- A friend is someone we can count on

Przyjaciel to ktoś, komu ufamy- A friend is someone we trust

Nie będzie mówić naszych sekretów innym osobom- She/he will not tell our secrets to other people

Przyjaciel to ktoś, kto zawsze nam pomoże- A friend is someone who will always help us

Przyjaciel to ktoś, kto nas rozbawi- A friend is someone who makes us laugh

Przyjaciel to ktoś, komu możemy powiedzieć o wszystkim- A friend is someone we can tell about everything

Przyjaciel to ktoś, z kim lubimy spędzać czas- A friend is someone we like to spend time with

Wspólne pasje, zainteresowania- Common passions, interests

Przyjaciel to ktoś, kto o nas dba- A friend is someone who cares about us

Bratnia dusza- Soulmate

Czy Ty masz przyjaciela?- Do you have a friend?

Czy warto mieć przyjaciela?- Is it worth having a friend?

Napiszcie komentarze- Write comments

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about what I like to do in Summer.

All Social Media + Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:'

Lato- Summer

Wszyscy ludzie lubią lato- All people like summer

Za co lubimy lato?- What do we like summer for?

Lubię lato za słońce- I like summer for the sun

Lubię lato za truskawki i czereśnie- I like summer for strawberries and cherries

Lubię lato za pyszne, zdrowe, świeże owoce- I like summer for delicious, healthy, fresh fruit

Lubię lato za wakacje- I like summer for vacation

Ludzie są nad jeziorem- People are by the lake

Ludzie są nad morzem- People are at the seaside

Ludzie lubią lato za ciepłą wodę w morzu, w jeziorze- People like summer for warm water in the sea, in the lake

Lato lubimy za lody- We like summer for ice cream

Lato lubimy za piękne kwiaty- We like summer for beautiful flowers

Lubię lato za długie dni- I like summer for long days

Zimą dzień jest bardzo krótki- In winter, the day is very short

Lubimy lato za świeże warzywa- We like summer for fresh vegetables

Warzywa możemy kupić na rynku- We can buy vegetables on the market

Latem często spotykamy się z przyjaciółmi- In summer, we often meet with friends

Lubię lato za przygody- I like summer for adventures

Lubię lato za basen- I like summer for the pool

Lubię lato za kolorowe motyle- I like summer for colorful butterflies

Lubię lato za las- I like summer for the forest

Za co lubicie lato? Napiszcie swoje odpowiedzi- What do you like summer for? Write your answers

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about Prosba o Rade (Request for Advice).

All Social Media + Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:'

Prośba o radę- Request for advice

Doradzanie- Advising

Odradzanie- Advising against

Co mi radzisz?- What are you advising me?

Radzę Ci, żebyś kupił nowy samochód- I advise you to buy a new car

Co mam zrobić?- What should I do?

Co zrobiłbyś/zrobiłabyś na moim miejscu?- What would you do in my place?

Co powinienem/powinnam zrobić?- What should I do?

Możesz mi coś doradzić?- Can you advise me something?

Na Twoim miejscu kupiłabym nowy dom- If I were you, I would buy a new house

Gdybym była Tobą zrobiłabym więcej podcastów- If I were you, I'd do more podcasts

Warto kupić nowy samochód- It's Worth to buy a new car

Powinieneś uczyć się polskiego- You should learn Polish

Radzę Ci żebyś powtarzał gramatykę regularnie- I advise you to repeat grammar regularly

Nie powinieneś tego robić- You shouldn't do this

Nie powinnaś pić dużo alkoholu- You shouldn't drink a lot of alcohol

Nie rób tego- Do not do this

Odradzam Ci to- I advise you against it

Nie warto kupować nowego samochodu- It is not worth to buy a new car

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about getting married.

All Social Media + Donations https://linktr.ee/learnpolish

Spotify https://open.spotify.com/show/0ZOzgwHvZzEfQ8iRBfbIAp

Apple https://podcasts.apple.com/us/podcast/learn-polish-podcast/id1462326275

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:'

Zwierzęta- Animals

Byk- Bull

Małpa- Monkey

Świnka- Pig

Byczyć się (odpoczywać, nic nie robić)- Resting, doing nothing

On nic nie robi cały dzień, tylko byczy się i ogląda telewizję- He doesn't do anything all day, just lazes around and watches TV

Czy ty lubisz byczyć się?- Do you like to laze around?

Myślę, że wieczorami byczysz się- I think that in the evenings you laze around

Małpować (robić to samo, naśladować)- To mimic (do the same, imitate)

Dlaczego małpujesz mój styl ubierania się?- Why do you mimic my dress style?

Czy Ty małpujesz innych ludzi?- Do you mimic other people?

Uświnić się (być brudnym)-To be dirty

Nasz syn się cały uświnił- Our son was all dirty

Kiedy ostatni raz uświniłeś się?- When was the last time you were all dirty?

Ludzie małpują- People mimic

Dzieci w szkole małpują- Kids at school mimic

Napisz przykłady w komentarzach- Write examples in the comments

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about getting married.

All Social Media + Donations https://linktr.ee/learnpolish

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:'

Ślub- Wedding

Para młoda- Young couple

Pan młody- Groom

Panna młoda- Bride

Co ma na sobie pan młody?- What is the groom wearing?

Garnitur- Suit

Biała suknia- White dress

Oni wzięli ślub- They got married

Ożenić się (mieć żonę)- To get married (to have a wife)

Wyjść za mąż (mieć męża)- To get married (to have a husband)

Pobrać się (on plus ona)- To get married (he plus she)

Żyć w pojedynkę (być singlem)- Live alone (to be single)

Szczęśliwy miesiąc żeby brać ślub (R w nazwie)- Happy month to get married (R in the name)

Sierpień to popularny miesiąc na ślub- August is a popular month for a wedding

Napiszcie w komentarzach czy jesteście po ślubie- Write in the comments if you are married

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about expressing hope (wyrazanie nadziei).

All Social Media + Donations https://linktr.ee/learnpolish

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Wyrażać nadzieję- Express hope

Wierzę, że- I belive that

Wierzę, że będę zdrowa- I believe that I will be healthy

Wierzę, że jeśli myślimy pozytywnie to jesteśmy pozytywni- I believe that if we think positively, we are positive

Ufam, że- I trust that

Ufam, że mój syn znajdzie dobrą pracę- I trust that my son will find a good job

Ufam, że nauczę się polskiego- I trust that I will learn Polish

Mam nadzieję, że- I hope that

Mam nadzieję, że nie będzie już lockdownu- I hope there will be no lockdown anymore

Mam nadzieję, że pogoda będzie zawsze piękna- I hope the weather will always be beautiful

Mam nadzieję, że pojadę na wakacje- I hope to go on vacation

W tej kwestii jestem optymistą (-ką)- I am an optimist on this point

Wszystko się uda- Everything will be done

Masz dużo rzeczy do zrobienia, ale mało czasu- You have a lot of things to do, but little time

Nie uda mi się zdać egzaminu- I will not manage to pass en exam

Nie uda mi się nauczyć języka chińskiego- I will not manage to learn Chinese

Masz coś do zrobienia?- Do you something to do?

Będzie dobrze- It will be fine

Liczę, że będzie dobrze- I hope it will be fine

Liczę, że jutro będzie ładna pogoda- I hope that the weather will be nice tomorrow

Liczę, że napiszecie pracę domową- I hope you will write your homework

Napiszcie kilka przykładów- Write a few examples

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about Animals.

All Social Media + Donations https://linktr.ee/learnpolish

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Zwierzęta- Animals

Zwierzęta poprawiają humor- Animals improve mood

Poprawiać humor- Improve mood

Pies- Dog

Czy masz psa?- Do you have a dog?

Piesek jest ładny- The dog is cute

Duży kot- Big cat

Mały kotek- Little cat (kitty)

Chomik- Hamster

Kanarek- Canary

Lubię jak kanarki śpiewają- I like how canaries sing

Żółw- Turtle

Żółw lądowy- Land turtle

Żółw wodny- Water turtle

Królik- Rabbit

Ja mam królika- I have a rabbit

Wąż- Snake

Bardzo lubię krowy- I really like cows

Krowy dają mleko- Cows give milk

Świnia- Pig

Facet to świnia (polska piosenka)- Guy is a pig (Polish song)

Kura- Hen

Kurczaki- Chickens

Kogut- Rooster

Koń- Horse

Uczę się jeździć konno- I'm learning to ride a horse

Jakie jest macie zwierzę, jakie jest wasz ulubione zwierzę?- What is your animal like, what is your favorite animal?

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about words for Ale(But) & Albo(or)

All Social Media + Donations https://linktr.ee/learnpolish

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Jak budować zdania- How to build sentences

Albo, Lub, Czy, Bądź- Or

Rano piję kawę albo herbatę- In the morning I drink coffee or tea

Na śniadanie jem kanapkę albo płatki z mlekiem- For breakfast I eat a sandwich or cereal with milk

Piję piwo alkoholowe albo bezalkoholowe- I drink alcoholic or non-alcoholic beer

Być albo nie być - To be or not to be

Pojadę do Francji albo do Włoch- I will go to France or Italy

Pójdziemy do kina lub oglądamy film w domu- We will go to the cinema or watch a movie at home

Zupa pomidorowa czy zupa ogórkowa- Tomato soup or cucumber soup

Keczup czy majonez- Ketchup or mayonnaise

W weekend pojadę do lasu bądź pójdę na spacer- On the weekend I will go to the forest or go for a walk

Ale, lecz, natomiast, jednak – But

Przepraszam, ale w czwartek nie mam czasu- I'm sorry, but on Thursday I don't have time

Chcę, ale nie mogę- I want but I can not

Chciałbym tan pojechać, lecz niestety nie mam urlopu- I would like to go there, but unfortunately I do not have holiday

Zrobiłbym to, natomiast nie wiem jak- I would do it, but I don't know how

Chciał to zrobić, jednak nie umiał- He wanted to do it, but could not

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about slang for money.

All Social Media + Donations https://linktr.ee/learnpolish

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Pieniądze- Money

Lubię rozmawiać o pieniądzach-I like to talk about money

Nieformalne synonimy- Informal synonyms

Język nieoficjalny- Unofficial language

Szmal- Money, cash

Siano- Money, cash

Forsa- Money, cash

Kapusta- Money, cash

Kapucha- Money, cash

Kasa- Money, cash

Kaska- Money, cash

Kasiora- Money, cash

Hajs- Money, cash

Nie mam szmalu- I have no money

Masz siano?- Do you have money?

Masz forsę?- Do You have money?

Potrzebuję kapusty- I need money

Chciałbym kupić nowe buty, ale nie mam kasy- I would like to buy new shoes, but I have no money

Nie mam kaski- I have no money

Napisz w komentarzach trzy przykłady- Write three examples in the comments

Mam kasę i mogę kupić nową książkę- I have money and I can buy a new book

Muszę pożyczyć trochę forsy na wakacje- I need to borrow some money for the holidays

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about children's day.

All Social Media + Donations https://linktr.ee/learnpolish

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Dzień dziecka - Children's Day

Święto - Holiday

Dajemy dzieciom prezenty - We give children gifts

Komercja - Commercial

Dzień dziecka jest codziennie - Children's Day is everyday

Opiekować się - To look after, to take care

Bawić się z dziećmi - Play with the children

Chodzić na spacery - To go for walks

Kiedy byłeś małym dzieckiem - When you were a little kid

Co robiłeś kiedy byłeś dzieckiem? - What did you do when you were a kid?

Ludzie grali w piłkę nożną - People were playing football

Teraz oglądamy dużo telewizji - Now we watch a lot of TV

Każdy czyta wiadomości w komórce - Everyone reads messages on the mobile

Dzieciństwo - Childhood

Dużo zabawy i cukierków - Lots of fun and candy

Każdy z nas jest dzieckiem - Each of us is a child

Życzymy wam dużo uśmiechu, radości, cukierków - We wish you a lot of smile, joy, candy

Co lubiliście robić kiedy byliście dziećmi? - What did you like to do when you were kids?

Ja robię lody naturalne z owoców sam - I make natural fruit ice cream myself

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about different ways of saying 'Nothing'.

All Social Media + Donations https://linktr.ee/learnpolish

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Nic- Nothing

Nic nowego- Nothing new

Nic nie robię- I do nothing

Nic nie szkodzi- Do not worry

Nie mamy niczego nowego- We have nothing new

Niczego nie żałuję- I do not regret anything

Niczym się nie martw- Don't worry about anything

O niczym innym nie marzę, tylko o psie- I dream of nothing else but a dog

Niczemu się nie dziwię- Nothing to wonder, I'm not surprised

Nic dzisiaj nie jem- I don't eat anything today

Nic dzisiaj nie piję- I don't drink anything today

Nie widzę niczego- I don't see anything

Niczego nie słyszę- I don't hear anything

Nie mam niczego w lodówce- I have nothing in the fridge

Nie mam benzyny- I have no petrol

Niczym się nie interesuję- I'm not interested in anything

O niczym nie myślę- I don't think about anything

O niczym nie marzę- I don't dream of anything

Niczemu się nie przyglądam- I'm not looking at anything

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about shopping.

All Social Media + Donations https://linktr.ee/learnpolish

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Zakupy- Shopping

Piątek- Friday

Poniedziałek- Monday

Lubisz zakupy?- Do you like shopping?

Jak często chodzisz na zakupy?- How often do you go shopping?

Gdzie robisz zakupy?- Where do you do shopping?

Płacisz kartą czy gotówką?- Do you pay by card or in cash?

Idę na zakupy do Lidla- I'm going shopping at Lidl

Zawsze robię zakupy w sobotę- I always do shopping on Saturday

Produkty wegańskie- Vegan products

Wegetariańska szynka- Vegetarian ham

Co jest najłatwiej zrobić do pracy?- What's easiest to do to work?

Nie cierpię zakupów- I hate shopping

Co jemy dzisiaj na obiad?- What are we eating for dinner today?

Jestem na zakupach- I'm shopping

Czy możesz zrobić dzisiaj zakupy?- Can you do shopping today?

Zakupy online- Online shopping

W sklepach musimy mieć maseczki- We must have masks in stores

Gdzie wy robicie zakupy, czy lubicie robić zakupy, ile czasu spędzacie w sklepie?- Where do you do shopping, do you like to do shopping, how much time do you spend in the store?

Kupować na rynku- Buy in the market

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about ways for planning your weekend.

All Social Media + Donations https://linktr.ee/learnpolish

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Kiedy będzie weekend ja planuję pojechać na wieś- When the weekend will come, I plan to go to the country

Ja i mój syn planujemy jeździć konno- Me and my son are planning to ride a horse

Będę grał w piłkę z moim synem- I will play football with my son

Jakie macie plany na weekend?- What are your plans for the weekend?

Planuję odpocząć-I plan to rest

Wyspać się-Get enough sleep

Obejrzeć film -Watch a movie

Poćwiczyć- Exercise

Posłuchać muzyki- Listen to music

Pojeździć na rowerze- Ride a bike

Odwiedzić rodziców- Visit parents

Planuję zadzwonić do babci- I plan to call my grandmother

Planuję uczyć się polskiego w weekend-I plan to learn Polish during the weekend

Jakie Wy macie plany na weekend?- What are your plans for the weekend?

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about the difference ways to request something (Zaproszenie)

All Social Media + Donations https://linktr.ee/learnpolish

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Zapraszać- Invite

Zaproszenie- Invitation

Czy jesteś zajęty w poniedziałek?- Are you busy on Monday?

Czy chciałabyś?- Would you like?

Czy masz ochotę na spacer?- Would you like to go for a walk?

A może byśmy ?- Maybe we would? / What about?

Zróbmy coś- Let’s do something

A co powiesz żebyśmy?- Would you say for?

Zastanawiałem się czy zechciałabyś- I was wondering if you would like (Male)

Zastanawiałem się czy zechciałaby Pani-I was wondering if You would like(Female)

Czy jesteś zajęta później?- Are you busy later?

Kamila czy chciałbyś pojechać na plażę?- Kamila would you like to go to the beach?

Czy masz ochotę na kawę?- Would you like some coffee?

Czy masz ochotę pójść do kina?- Do you want to go to the cinema?

A może byśmy poszli do kina?- How about going to the cinema?

A może byśmy kupili samochód?- How about buying a car?

A może byśmy poszli na spacer?- What about going for a walk?

Zróbmy pracę domową- Let's do homework

Uprawiajmy sztukę- Let's practice art

A co powiesz na to, abyśmy obejrzeli film?- What would you say if we watch a movie?

Zastanawiałem się, czy zechciałbyś pójść ze mną na rynek - I was wondering if you would like to go to the market with me

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about the difference between Grac Na & Grac W.

All Social Media + Donations https://linktr.ee/learnpolish

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Rośliny- Plants

Zioła- Herbs

Kwiaty- Flowers

Woda+ cytryna+ mięta- Water + lemon + mint

Pozytywne uczucia- Positive feelings

Nie mam nic przeciwko (muzyce POP)- I have nothing against (POP music)

Nie mam nic przeciwko ludziom, którzy uczą się jeździć- I have nothing against people learning to drive

Ja lubię zupę ogórkową, pomidorową- I like cucumber and tomato soup

Ja lubię podcasty- I like podcasts

Wszyscy Polacy lubią zupę pomidorową- All Poles like tomato soup

Uwielbiam lody czekoladowe- I love chocolate ice cream

Uwielbiam leżeć na plaży- I love to lie on the beach

Uwielbiam pływać- I love swimming

Szaleję za mięsem- I'm crazy about meat

Szaleję za pizzą- I'm crazy about pizza

Szaleję za kawą z mlekiem- I'm crazy about coffee with milk

Kocham świeże owoce i warzywa- I love fresh fruits and vegetables

Kocham jeździć na rowerze- I love cycling

Kocham medytować- I love to meditate

Kocham moją rodzinę- I love my family

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about ways of expressing positive feelings.

All Social Media + Donations https://linktr.ee/learnpolish

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Grać w- To play

Grać na- To play

Grać na gitarze- Play the guitar

Grać na pianinie- Play the piano

Grać na flecie- Play the flute

Grać na bębenku- Play the drum

Czy umiesz grać na bębenku?- Can you play the drum?

Czy umiesz grać na gitarze?- Can you play guitar?

Czy umiesz grać na pianinie?- Can you play the piano?

Grać na nerwach- Play on the nerves

Denerwuję ludzi- I annoy people

Grać w tenisa- Play tennis

Grać w hokeja- Play hockey

Grać w piłkę nożną- Play football

Czy umiesz grać w golfa?- Can you play golf?

Czy umiesz grać w hokeja?- Can you play hockey?

Na pewno grasz w piłkę nożną- You definitely play football

Czy umiecie grać na saksofonie?- Can you play the saxophone?

W co lubicie grać?- What do you like to play?

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about 6 Ways to say I Understand or Don't Understand (6 Sposobow zeby Powiedziec)

All Social Media + Donations https://linktr.ee/learnpolish

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Rozumiem- I understand

Nie rozumiem- I do not understand

Czaję- I understand

Nie czaję- I do not understand

Kumam- I understand

Kumasz polską gramatykę?- Do you understand Polish grammar?

Ogarniam- I get it

Nie ogarniam- I do not get it

Nie mogę zrozumieć- I can not understand

Nie chwytam- I do not get it

Nie łapię- I do not get it

Nie czaję tego, to jest bardzo skomplikowane- I can't get it, it's very complicated

Czy Wy znacie te słowa?- Do you know these words?

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about Ways to say I'm I know(Znam & Wiem)

All Social Media + Donations https://linktr.ee/learnpolish

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Wiem- I know

Znam- I know

Znam osobę- I know a person

Znam Twoją siostrę- I know your sister

Znam tego nauczyciela- I know this teacher

Znam tego człowieka- I know this man

Znam Polskę- I know Poland

Znam Warszawę- I know Warsaw

Znam polskie filmy- I know Polish movies

Znam polską gramatykę- I know Polish grammar

Znam język polski- I know Polish

Znam język angielski- I know English

Wiem gdzie jest Polska- I know where Poland is

Wiem jak on się nazywa- I know his name

Wiem jak się dzisiaj masz- I know how you are doing today

Wiem skąd jesteś- I know where you are from

Wiem gdzie mieszka twoja babcia- I know where your grandmother lives

Wiem jak on ma imię- I know his name

Wiem, że jesteś dzisiaj pełna energii- I know you are full of energy today

Wiem ile masz lat- I know how old you are

Napiszcie pięć przykładów ZNAM, pięć przykładów WIEM- Write five examples I KNOW, five examples I KNOW

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about Ways to say I'm Visiting (Zwiedza i odwiedza - jaka jest roznica).

All Social Media + Donations https://linktr.ee/learnpolish

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Odwiedzać- To visit

Zwiedzać- To sightsee

Zwiedzać miejsce- Sightsee the place

Zwiedzać miasto, Manufakturę- Sightsee the city, Manufaktura

Odwiedzać babcię, rodzinę, koleżankę- Visit my grandmother, family, friend

Ja zwiedzam muzeum- I sightsee the museum

Ja odwiedzam przyjaciółkę- I visit my friend

Ja zwiedzam Irlandię- I sightsee Ireland

Ja odwiedzam moją rodzinę- I visit my family

Czy lubisz zwiedzać nowe miejsca?- Do you like shightseeing new places?

Lubię zwiedzać Wrocław, tam są piękne zabytki- I like to sightsee Wrocław, there are beautiful monuments there

Nie lubię zwiedzać muzeów- I don't like sightseeing museums

Kogo lubisz odwiedzać?- Who do you like to visit?

Lubię odwiedzać moją córkę- I like to visit my daughter

Zwiedzałem Irlandię i odwiedzałem swoją rodzinę- I was shightseeing Ireland and visiting my family

Po pandemii planuję zwiedzić Egipt- After the pandemic, I plan to sightsee Egypt

Chciałbym odwiedzać swoją rodzinę- I would like to visit my family

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about Ways of Expressing In my Opinion (Sposoby wyrażania opinii.

All Social Media + Donations https://linktr.ee/learnpolish

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about losing weight.

All Social Media + Donations https://linktr.ee/learnpolish

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Jaki jest efekt?- What's the effect?

Przytyć- Gain weight

Więcej kilogramów- More kilos

Czy Ty przytyłeś?- Have you gained weight?

Ja przytyłam sześć kilogramów- I gained six kilos

Odchudzać się- To lose weight

Ty chcesz schudnąć- You want to lose weight

Jaką dietę planujesz zastosować?- What diet do you plan to follow?

Nie będę jeść chleba i pizzy- I will not eat bread and pizza

Będę robił więcej ćwiczeń- I will do more exercises

Spodnie są za małe- Trousers are too small

Musisz ograniczyć gluten, cukier- You need to limit on gluten, sugar

Nie chcecie zrezygnować z lodów- You don't want to give up ice cream

Dieta sokowa- Juice diet

Tylko pijesz soki- You only drink juices

Soki warzywne- Vegetable juices

Soki owocowe- Fruit juices

Czy Wy macie taki sam problem jak my? – Do you have the same problem as we have?

Toksyny- Toxins

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about morning bathroom routine.

All Social Media + Donations https://linktr.ee/learnpolish

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Poranna rutyna- Morning routine

Poranna toaleta- Morning toilet

Kobieta ma ręcznik na głowie- The woman has a towel on her head

Piżama- Pajamas

Ona jest w łazience- She is in the bathroom

Ona brała prysznic, myła włosy- She was taking a shower, washing her hair

Robić siku- To pee

Robić kupę- Do poop

Załatwiać się- To toilet (dispose)

Brać prysznic- To take a shower

Myć się- To wash

Myć zęby- To brush teeth

Myć twarz- To wash face

Myć włosy- To wash hair

Czesać się- To comb

Szczotkować włosy- To brush hair

Układać fryzurę- To style a hairstyle

Robić makijaż- To do makeup

Ubierać się- To dress

Biorę prysznic- I take a shower

Nic dentystyczna- Dental floss

Skrobaczka do języka- Tongue scraper

Myję włosy- I wash my hair

Czeszę się- I brush my hair

Masz ułożoną fryzurę, użyłeś żelu- You have a styled hairstyle, you used a gel

Jak wygląda wasza poranna rutyna?- What is your morning routine like?

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about gardening.

All Social Media + Donations https://linktr.ee/learnpolish

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Ogród- Garden

To jest ogród-This is the garden

Gdzie idziesz?- Where are you going?

Gdzie pracujesz?- Where do you work?

Pracuję w ogrodzie-I work in the garden

Jaki masz ogród?- What kind of garden do you have?

Mam średni ogród-I have a medium garden

Mam trochę trawy-I have some grass

Gram w piłkę nożną z moim synem-I play football with my son

Jakie masz kwiaty?- What flowers do you have?

Czy lubisz pracować w ogrodzie?- Do you like working in the garden?

W ogrodzie lubię relaksować się, czytać książki- I like to relax, read books in the garden

Robić grilla- To make a barbecue

Kto pracuje w Twoim ogrodzie?- Who works in your garden?

Koszę trawę- I mow the grass

Inni ludzie zajmują się kwiatami, chwastami- Other people take care of flowers, weeds

Ja mam bardzo mały ogród- I have a very small garden

Planuję zorganizować trzy duże skrzynie-I plan to organize three big chests

Pomidory, sałata- Tomatoes, lettuce

Możecie zorganizować swój mini ogródek na balkonie- You can organize your mini garden on the balcony

Co o tym myślicie?- What do you think about this?

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about what you should and shouldn't do.

All Social Media + Donations https://linktr.ee/learnpolish

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Nie ma dzisiaj słońca- There is no sun today

Jest brzydka pogoda- It's bad weather

Powinien- Should

Ja powinienem- I should

Ty powinieneś- You should

On powinien- He should

Co powinieneś dzisiaj robić?- What should you do today?

Ja powinienem edytować podcasty- I should edit podcasts

Ja powinienem skończyć biznesplan- I should finish a business plan

Czego nie powinieneś robić?- What shouldn't you do?

Ja nie powinienem się stresować- I shouldn't be stressed

Nie powinienem pić dużo kawy- I shouldn't drink a lot of coffee

Nie powinienem jeść dużo czekolady- I shouldn't eat a lot of chocolate

Ja powinnam- I should

Ty powinnaś- You should

Ona powinna- She should

Ja dziś powinnam zrobić zakupy- I should do shopping today

Powinnam ugotować obiad- I should cook dinner

Powinnam posprzątać dom- I should clean the house

Nie powinnam stresować się- I shouldn't be stressed

Nie powinnam krzyczeć- I shouldn't scream

Co powinnam/powinienem robić żeby nie chorować?- What should I do in order not to get sick?

Osoba powinna brać witaminę D- A person should take vitamin D

Osoba powinna uprawiać sport- A person should play sports

Osoba powinna dużo spać- A person should sleep a lot

Osoba nie powinna pić wody z kranu- A person should not drink tap water

Co Wy dzisiaj powinniście robić?- What should you do today?

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about working from home.

All Social Media + Donations https://linktr.ee/learnpolish

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Praca- Work

Praca stacjonarna (idziesz do pracy, biura)- Stationary work (you go to work, office

)

Praca zdalna (pracujesz przy komputerze w domu)- Remote work (you work on your computer at home)

Plus i minusy pracy zdalnej w domu- The pros and cons of working remotely from home

Plusy-Pros

Praca przez internet- Internet work

Mniej stresu- Less stress

Nie muszę wcześniej wstawać- I don't have to get up earlier

Nie musimy jechać do innego miejsca- We don't have to go to another place

Mamy więcej czasu kiedy pracujemy w domu- We have more time when we work from home

Nie stoimy w korkach- We do not stand in traffic jams

Więcej czasu dla dzieci, dla partnera- More time for children, for a partner

Minusy- Cons

Więcej samodyscypliny- More self-discipline

Nie chce nam się wstać- We do not want to get up

Nie chce nam się ubrać- We don't want to get dressed

Brak kontaktu z innymi- No contact with others

Nie ma słońca- There is no sun

Nie ma ruchu- There is no movement

Nie ma kontaktu z przyrodą- There is no contact with nature

Proponuję spacery, iść na świeże powietrze- I suggest walking, going to the fresh air

Czy wy pracujecie zdalnie? Czy lubicie pracę zdalną? Czy wolicie pracę stacjonarną?

Do you work remotely? Do you like remote work? Do you prefer stationary work?

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about planning your week.

All Social Media + Donations https://linktr.ee/learnpolish

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Tygodniowy plan- Weekly plan

Poniedziałek rano- Monday morning

Ja pracuję- I work

Do godziny 12- Till 12 pm

Ja mam lekcje- I have lessons

Jem śniadanie- I eat breakfast

Edytuję podcasty- I edit podcasts

Co robisz w poniedziałek po południu?- What do you do on Monday afternoon?

Ja odpoczywam- I am resting

Ja odbieram mojego syna- I pick up my son

Wieczorem gotuję obiad- In the evening I cook dinner

Oglądamy film- We watch a movie

Co robisz we wtorek rano?- What do you do on Tuesday morning?

Jem śniadanie- I eat breakfast

Robię zakupy, idę do sklepu- I'm shopping, I'm going to the store

Czasami mam spotkanie- Sometimes I have a meeting

Bawię się z synem- I'm playing with my son

Po południu czytam książkę, artykuły- In the afternoon I read a book, articles

Wieczorem mam wizytę u dentysty- In the evening I have an appointment with the dentist

W środę rano ćwiczę- On Wednesday morning I exercise

Rozmawiam z mamą- I am talking to my mother

Po południu idę do parku- In the afternoon I go to the park

Wieczorem śpię, odpoczywam- In the evening I sleep, I rest

W czwartek rano robię kanapkę na śniadanie- On Thursday morning I make a sandwich for breakfast

Czytam informacje w internecie- I read information on the internet

Spotykam się z kolegami- I'm meeting my colleagues

W piątek rano idę do banku- On Friday morning I go to the bank

Po południu w piątek ludzie idą do kina, do restauracji- On Friday afternoon, people go to the cinema, to restaurants

W piątek wieczorem śpię- On Friday evening I sleep

Jaki jest wasz plan tygodnia, jakie macie plany?- What's your schedule of the week, what are your plans?

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about more Polish Idioms.

All Social Media + Donations https://linktr.ee/learnpolish

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Idiomy- Idioms

Komuś brakuje słów- Someone lacks words

Brakuje mi słów- I lack words

Widzę coś pięknego, nie mogę tego opisać- I see something beautiful, I can't describe it

Coś jest okropne, brakuje mi słów- Something is terrible, I miss the words

Dać słowo- To give word

Ostateczna decyzja- The final decision

Jednym słowem (krótko mówić)- In a word (briefly speaking)

Innymi słowy (inaczej mówiąc)- In other words

Szkoda słów (nie warto mówić)- Waste one’s breath (not worth saying)

Kiedy mój syn się urodził byłem bardzo szczęśliwy i brakowało mi słów- When my son was born I was very happy and I missed the words

Dać słowo – To give the word

Dałem Ci słowo, że zrobię prezentację za tydzień- I gave you my word that I would make a Presentation in a week

Ostatnie słowo- Last word

To moje ostatnie słowo (negocjacje)- This is my last word (negotiation)

On jest jednym słowem idealny- He is in one word perfect

Irlandia innymi słowy to zielony kraj- Ireland, in other words, is a green country

Kiedy ktoś nie słucha co mówisz i robi co chce, szkoda słów- When someone does not listen to what you say and does what he wants, it's a waste of words

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about Easter.

All Social Media + Donations https://linktr.ee/learnpolish

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Wielkanoc- Easter

Bardzo ważne święto- A very important holiday

Święto religijne- Religious holiday

Koszyk Wielkanocny (święconka)- Easter basket

Co jest w koszyku wielkanocnym?- What's in the Easter Basket?

Jajka- Eggs

Polacy malują, dekorują jajka- Poles paint, decorate eggs

Pisanki (kolorowe, malowane jajka)- Easter eggs (colored, painted eggs)

Baranek cukrowy- Sugar lamb

Zając wielkanocny z czekolady- Chocolate Easter Bunny

Krzyż- Cross

Chleb (kromka chleba)- Bread (slice of bread)

Sól- Salt

Pieprz- Pepper

Masło- Butter

Babka wielkanocna (ciasto)- Easter cake (cake)

Kawałek kiełbasy- A piece of sausage

Idziemy do kościoła- We go to church

Ksiądz święci jedzenie- Priest blesses food

Wesołych Świąt Wielkanocnych- Happy Easter

Czy w waszym kraju obchodzicie Wielkanoc?- Do you celebrate Easter in your country?

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about describing your car.

All Social Media + Donations https://linktr.ee/learnpolish

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Samochody- Cars

Biały samochód- White car

Jaki jest ten samochód?- What is this car like?

On jest ładny- He is nice

Nowy, szybki, nowoczesny- New, fast, modern

Czy Ty masz samochód?- Do you have a car?

Jaki masz samochód?- What car do you have?

Nie dużo zrobiłem kilometrów- I didn't do much kilometers

Czy lubisz ten samochód?- Do you like this car?

Ogrzewane fotele- Heated seats

Czy Ty lubisz jeździć?- Do you like to drive?

Kierownica- Steering wheel

Czuć się dobrze za kierownicą- To feel good behind the wheel

Kierowca- Driver

Zdałeś egzamin- You passed the exam

Czy jeździsz do pracy?- Do you drive to work?

Jak często podróżujesz samochodem?- How often do you travel by car?

Kiedy odbieram moje dziecko- When I pick up my child

Byłem w Estonii i w Chorwacji- I've been to Estonia and Croatia

Jechałem dwanaście godzin- I drove twelve hours

Jaki jest Twój ulubiony środek transportu?- What is your favourite kind of transport?

Do lasu lubię jeździć rowerem- I like to ride a bike to the forest

Do innego miasta samochodem- To another city by car

Jaki samochód chciałbyś mieć?- What car would you like to have?

Sprzedałem samochód- I sold a car

Warsztat samochodowy- Car repair shop

Samochód się psuje- The car breaks down

Było tylko pięć wizyt- There were only five visits

Przegląd samochodu- Car review

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about r

.

All Social Media + Donations https://linktr.ee/learnpolish

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Prośby- Requests

Czy możesz?- Can you?

Czy możesz mi pomóc?- Can you help me?

Czy możesz zrobić mi kawę?- Can you make me a coffee?

Czy możesz kupić dobry mikrofon?- Can you buy a good microphone?

Czy możesz pójść ze mną do kina?- Can you go to the cinema with me?

Czy możesz pomóc mi pomalować ściany?- Can you help me paint the walls?

Czy możesz mi wytłumaczyć?- Can you explain to me?

Czy możesz powtórzyć?- Can you repeat?

Czy możesz iść do sklepu?- Can you go to the store?

Czy możesz przetłumaczyć ten tekst?- Can you translate this text?

Czy mógłbyś, czy mogłabyś?- Could you, could you?

Czy mógłbyś otworzyć okno?- Could you open the window?

Czy mógłbyś powtórzyć ten tekst?- Could you repeat this text?

Czy mogłabyś pomóc mi z księgowością?- Could you help me with accounting?

Czy mogłabyś mówić głośniej?- Could you speak louder?

Czy mogłabyś posprzątać?- Could you clean up?

Proszę powiedz mi- Please tell me

Proszę idź- Please go

Proszę pomóż mi- Please help me

Czy zrobiłbyś mi obiad?- Would you make me dinner?

Czy kupiłbyś mi gazetę?- Would you buy me a newspaper?

Czy napisałbyś?- Would you write?

Czy zrobiłabyś lekcję w każdą środę?- Would you do a lesson every Wednesday?

Czy umyłbyś okna?- Would you wash the windows?

Czy kupiłabyś mi nową książkę?- Would you buy me a new book?

Kup mi czekoladę- Buy me a chocolate

Napisz sms- Write SMS

Kup mi piwo- Buy me beer

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about Julian Tuwim's Poem.

.

All Social Media + Donations https://linktr.ee/learnpolish

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Poezja- Poetry

Polscy poeci- Polish poets

Poeta pisze wiersze- The poet writes poems

Czy Ty lubisz wiersze?- Do you like poems?

Wiersze humorystyczne- Humorous poems

Wiersze dla dzieci- Poems for children

Bardzo popularny polski poeta- A very popular Polish poet

Julian Tuwim pisał wiersze dla dzieci- Julian Tuwim wrote poems for children

Okulary- Glasses

Bohater -Hero

Pan Hilary szuka okularów- Mr. Hilary is looking for glasses

Gdzie są moje okulary- Where are my glasses

Szuka w bucie- He is looking in the shoe

Ktoś mi ukradł okulary- Someone stole my glasses

Pod kanapą- Under the couch

Na kanapie- On the couch

Szuka w pianinie- He is looking at the piano

Zerknął do lusterka- He glanced into the mirror

Ma je na własnym nosie- He has them on his nose

Jestem jak Pan Hilary- I'm like Mr. Hilary

Julian Tuwim

Biega, krzyczy pan Hilary: "Gdzie są moje okulary?"

Szuka w spodniach i w surducie, W prawym bucie, w lewym bucie.

Wszystko w szafach poprzewracał, Maca szlafrok, palto maca.

"Skandal! - krzyczy - nie do wiary! Ktoś mi ukradł okulary!"

Pod kanapą, na kanapie, Wszędzie szuka, parska, sapie!

Szuka w piecu i w kominie, W mysiej dziurze i w pianinie.

Już podłogę chce odrywać, Już policję zaczął wzywać.

Nagle zerknął do lusterka... Nie chce wierzyć... Znowu zerka.

Znalazł! Są! Okazało się, Że je ma na własnym nosie.

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about Spring detox.

All Social Media + Donations https://linktr.ee/learnpolish

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Byłam szybsza- I was faster

Wiosna nadchodzi- Spring is coming

Wiosną robimy porządki- We do cleanup in spring

Sprzątać dom- Clean the house

Myć okna- Clean windows

Zmieniać firanki- Change curtains

Czy masz w domu firanki?- Do you have curtains at home?

Mam żółte firanki- I have yellow curtains

Ja dwa dni temu zmieniłam firanki- I changed the curtains two days ago

Robić porządki w szafie- To clean up the closet

Zimowe ubrania- Winter clothes

Wyciągamy letnie ubrania- We take out summer clothes

Kiedy planujesz wiosenne porządki?- When are you planning spring cleaning?

Wiosenne porządki w głowie- Spring cleaning in the mind

Umysł- Mind

W naszym umyśle w głowie jest stres, niepokój- There is stress in our mind, anxiety in our mind

Zrelaksować- Relax

Można iść na spacer- You can go for a walk

Słuchać śpiewu ptaków- Hear the birds sing

Relaksacyjna muzyka- Relaxing Music

Oczyszczanie naszego ciała- Cleansing our bodies

Zimą dieta jest bardzo kaloryczna- In winter, the diet is very caloric

Mamy ochotę na koktajle, świeże warzywa- We want cocktails, fresh vegetables

Sałatka- Salad

Jogurt na śniadanie- Yogurt for breakfast

Bierzesz witaminy- You take vitamins

Sauna- Sauna

Robić detoks- Do detox

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about comparative and superlative forms of adjectives

All Social Media + Donations https://linktr.ee/learnpolish

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Stopniowanie- Gradation

Nowy- New

Mój telefon jest nowy- My phone is new

Twój telefon jest nowszy- Your phone is newer

Telefon mojego syna jest najnowszy- My son's phone is the newest

Stary- Old

Moja babcia jest stara- My grandmother is old

Twoja babcia jest starsza- Your grandmother is older

Kamila jest najstarsza- Kamila is the oldest

Mały- Small

Mój telefon jest mały- My phone is small

Twój telefon jest mniejszy- Your phone is smaller

Daniela telefon jest najmniejszy- Daniel's phone is the smallest

Mam mały dom- I have a small house

On ma mniejszy dom- He has a smaller house

Mam duży samochód- I have a big car

Karol ma największy samochód- Karol has the biggest car

Mam krótkie włosy- I have short hair

Ty masz krótsze włosy- You have shorter hair

Ona ma najkrótsze włosy- She has the shortest hair

Długa sukienka- Long dress

Dłuższa sukienka- Longer dress

Najdłuższa sukienka- The longest dress

Ja mam nowy zegarek, Ty masz nowszy zegarek- I have a new watch, you have a newer watch

Kolega ma najnowszy zegarek- A friend has the latest watch

Ja mam starego kota, Ty masz starszego kota- I have an old cat, you have an older cat

Nasz kolega ma najstarszego kota- Our friend has the oldest cat

Mam mały samochód, Ty masz mniejszy samochód- I have a small car, you have a smaller car

Nasz syn ma najmniejszy samochód- Our son has the smallest car

Ty masz duży ogród, ja mam większy ogród- You have a big garden, I have a bigger garden

On ma największy ogród- He has the biggest garden

Ja mam krótkie włosy- I have short hair

Ja mam długie spodnie do kolan, mam dłuższe spodnie do kostek- I have knee-length pants, I have longer ankle-length pants

Najdłuższe spodnie na plażę- The longest beach pants

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about different ways to cook.

All Social Media + Donations https://linktr.ee/learnpolish

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Smaczny temat- Tasty topic

Gotowanie- Cooking

Każdy lubi jeść- Everyone likes to eat

Na fotografii widzimy parę- In the photo we see a couple

Oni gotują- They cook

Oni robią sałatkę- They make a salad

Brokuły- Broccoli

Pomidory- Tomatoes

Sałata- Lettuce

Papryka- Pepper

Przyprawy- Spices

Musimy umyć warzywa- We have to wash the vegetables

Dodać sól, pieprz- Add salt, pepper

Patelnia- Pan

Co robimy na patelni?- What are we doing in the pan?

Na patelni smażymy- We fry in a pan

Ja smażę warzywa- I'm frying vegetables

Piekarnik- Oven

Piec- To bake

Możesz piec ziemniaki w piekarniku- You can bake potatoes in the oven

Ziemniaki gotowane w garnku- Potatoes boiled in a pot

Co gotujesz?- What are you cooking?

Gotować na parze- To steam

Warzywa na parze- Steamed vegetables

Dobry tłuszcz, zły tłuszcz- Good fat, bad fat

Surowe jedzenie- Raw food

Smażone jedzenie- Fried food

Jedzenie na parze- Steamed food

Jaka jest twoja ulubiona sałatka?- What's your favorite salad?

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about whatw e both miss since lockdown.

All Social Media + Donations https://linktr.ee/learnpolish

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Tęsknić- To miss

Tęsknię za domem- I miss home

Tęsknię za moim krajem- I miss my country

Tęsknię za mamą, za tatą- I miss my mom, I miss my dad

Za czym tęsknisz?- What do you miss?

Roy tęskni za podróżami- Roy misses travels

Tęsknię za restauracjami- I miss restaurants

Czy tęsknisz za górami?- Do you miss the mountains?

Wolę na żywo- I prefer live

On tęskni za spotkaniami- He misses meetings

Tęsknisz za oceanem?- Do you miss the ocean?

Tęsknisz za lataniem samolotami?- Do you miss flying on airplanes? -

Myślałam, że tęsknisz za podróżami- I thought you missed travel

Maseczka może być trochę niebezpieczna- The mask can be a bit dangerous

Tęsknię za czasami bez maseczki- I miss times without a mask

Tęsknię za słońcem i latem- I miss the sun and summer

Tęsknię za świeżymy owocami i warzywami- I miss fresh fruits and vegetables

Roy tęskni za pubem- Roy misses the pub

Za czym tęsknisz?- What do you miss?

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about International Woman's day

All Social Media + Donations https://linktr.ee/learnpolish

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Dzień Kobiet- Women's Day

Kobiety dostają kwiaty- Women get flowers

Tulipany- Tulips

Jakie kolory mają tulipany?- What colors do tulips have?

Żółte, fioletowe, czerwone- Yellow, purple, red

Mężczyźni kupują prezenty dla kobiet- Men buy gifts for women

Kartka dla swojej kobiety- A card for your woman

Jaka jest rola kobiety?- What is the role of a woman?

Ona musi zajmować się domem- She must take care of the house

Zajmować się dziećmi- To look after children

Sprzątać- To clean up

Gotować- To cook

Kobieta ma dużo funkcji- A woman has a lot of functions

Kobieta ma dużo zadań- A woman has a lot of tasks (duties)

Kiedyś kobiety nie pracowały- Once upon a time, women did not work

Czy w Irlandii jest Dzień Kobiet?- Is it Women's Day in Ireland?

Dajemy kwiaty wszystkim kobietom- We give flowers to all women

Złożyć życzenia z okazji Dnia Kobiet- To make wishes on Women's Day

Życzę Wam bardzo miłego dnia- I wish you a very nice day

Dużo miłości, dużo siły- Lots of love, lots of strength

Dużo szczęścia i cierpliwości dla mężczyzn- Lots of happiness and patience for men

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about a picture of walking in Spring.

All Social Media + Donations https://linktr.ee/learnpolish

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Spacerować- To walk

Spacer- Walk

Co widzimy na fotografii?- What do we see in the photo?

Rodzina- Family

Trzy pokolenia- Three generations

Babcia, mama dziecko- Grandma, mom, child

One spacerują- They are walking

Gdzie one są?- Where are they?

One są w lesie- They are in the forest

Jaki to jest dzień tygodnia?- What day of the week is it?

To jest niedziela- It is Sunday

Jak często chodzisz na spacery?- How often do you go for walks?

Z kim spacerujesz?- Who are you walking with?

Czy lubisz spacery w deszczu?- Do you like walking in the rain?

Spacerować po plaży boso- To walk on the beach barefoot

Lubisz spacerować w lesie?- Do you like walking in the woods?

Możemy słuchać muzyki- We can listen to the music

Ptaki- Birds

Wiosna to dobry czas na detoks- Spring is a good time to detox

Czy jeździłeś w tym roku już na rowerze?- Have you already cycled this year?

Jak one się czują?- How are they feeling?

One są bardzo szczęśliwe- They are very happy

Ruch to zdrowie- Moving is healthy

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

All Social Media + Donations https://linktr.ee/learnpolish

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we talk about different expressions with time.

All Social Media + Donations https://linktr.ee/learnpolish

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Czas- Time

Czy masz czas?- Do you have time?

Nie mam czasu uczyć się polskiego- I don't have time to learn Polish

Mam czas- I have time

Nie mam czasu- I have no time

Rychło w czas- Soon in time

Czekasz na nauczycielkę- You are waiting for the teacher

Na czas- On time

Zrobić projekt na czas- To make a project on time

Przyjechać na czas- To arrive on time

Czas to pieniądz- Time is money

Każda chwila jest cenna- Every moment is precious

Czas leczy rany- Time heals wounds

Koniec relacji- End of relationship

W swoim czasie- In it's time

Pójdę na studia w swoim czasie- I will go to study in my time

Będę uczyć się grać na gitarze w swoim czasie- I'll be learning playing the guitar in my time

Zabijać czas- To kill time

Mam dużo czasu i muszę robić coś żeby czas płynął szybciej- I have a lot of time and I have to do something to make time go faster

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we looked at a picture and described what we have seen.

All Social Media + Donations https://linktr.ee/learnpolish

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Opisywać fotografię- Describe the photo

Co widzimy na pierwszym planie?- What do we see in the foreground?

Dwie osoby, które są w restauracji- Two people who are in the restaurant

Pani ma talerz- The lady has a plate

Pan ma lampkę czerwonego wina- The men has a glass of red wine

Jak oni się czują?- How are they feeling?

Pani się uśmiecha- The lady is smiling

Pierwsza randka- First date

Patrzy prosto w oczy- He looks straight in the eyes

Długie czarne włosy- Long black hair

On ma garnitur- He has a suit

On jest elegancki- He is elegant

O czym oni rozmawiają?- What are they talking about?

Skończyli jedzenie- They finished eating

Oni planują wspólne życie- They are planning a life together

Co jest w tle?- What's in the background?

Różne sosy- Various sauces

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we discussed comparative and sublative verbs.

All Social Media + Donations https://linktr.ee/learnpolish

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Stopniowanie przysłówka- Graduation adverb

Dobrze- Good

Jak się czujesz?- How do you feel?

Dobrze, dziękuję- Good, thank you

Lepiej- Better

Ty mówisz lepiej- You speak better

Ty czujesz się lepiej- You feel better

Najlepiej- Best

Kasia wygląda dobrze- Kasia looks good

Roy wygląda lepiej- Roy looks better

Kamila wygląda najlepiej- Kamila looks the best

Latem czuję się najlepiej- I feel best in summer

Źle- Bad

Czuję się źle- I feel bad

Ty czujesz się gorzej- You feel worse

Najgorzej- Worst

On uczy się źle- He learns wrong

Jego kolega uczy się gorzej- His friend learns worse

Kasia uczy się nagorzej- Kasia learns the worst

Kiedy mam katar czuję się źle- When I have a runny nose I feel bad

Mało- Little

Jem mało- I eat little

Mniej- Less

Roy je mniej- Roy eats less

Moje dziecko je najmniej- My child eats the least

Mam najmniej energii- I have the least energy

Latem pracuję najmniej- In summer I work the least

Dużo- Much

Roy pracuje bardzo dużo- Roy works a lot

Kamila pracuje więcej- Kamila works more

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we discussed what are the 5 keys to a successful relationship.

All Social Media + Donations https://linktr.ee/learnpolish

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Zasada- Rule

Pięć zasad udanego związku- Five rules for a successful relationship

Szacunek- Respect

Szanować drugą osobę- To respect the other person

Tolerancja- Tolerance

Nie posprzątałaś domu- You didn't clean the house

Akceptacja- Acceptance

Akceptujemy drugą osobę- We accept the second person

Nikt nie jest doskonały- Nobody is perfect

Akceptujemy, że ta osoba ma wady- We accept that this person has disadvantages

Nie mamy oczekiwań- We have no expectations

Nie jesteśmy rozczarowani- We are not disappointed

Powinniśmy sam chcieć być perfekcyjni- We should want to be perfect

Ty jesteś dobrym przykładem- You are a good example

Relacje w pracy- Relations at work

Relacje w rodzinie- Relations in the family

Zasady ogólne- General rules

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we discussed what is love.

All Social Media + Donations https://linktr.ee/learnpolish

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Miłość -Love

Czym jest miłość?- What is love?

Kochać kogoś- To love somebody

Myślimy o ukochanej- We think about a loved one

Mówimy miłe słowa- We say kind words

Jesteś piękna- You're beautiful

Pomagamy- We help

Opiekować się- To take care

Prezenty- Gifts

Kiedy kogoś kochamy chcemy jej coś dać- When we love someone, we want to give her something

Namalować obraz- To paint the picture

Zerwać kwiatki- To pick flowers

Wspólnie spędzamy czas- We spend time together

Myślimy o drugiej sobie- We think about the other one

Każda osoba jest inna- Every person is different

Ważne jest żeby znać drugą osobę- It is important to know the other person

Komplementy- Compliments

Co jest dla was najważniejsze w relacji?- What is most important to you in the relationship?

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we discussed house cleaning.

All Social Media + Donations https://linktr.ee/learnpolish

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Sprzątanie- Cleaning

Czy lubisz sprzątać?- Do you like cleaning?

Tak, lubię sprzątać- Yes, I like to clean

Nie, nie lubię sprzątać- No, I don't like cleaning

Nie lubię, ale muszę- I don't like it, but I have to

Bałagan- Mess

Odkurzać- To vacuum

Mój syn odkurza- My son vaccumes

Mój syn lubi sprzątać- My son likes to clean

Myć podłogę- Wash the floor

Myć okna- Clean windows

Kurz- Dust

Wycierać kurze- Mop the dust

Sprzątać łazienkę- Clean the bathroom

Sprzątać kuchnię- Clean the kitchen

Zmywać naczynia- Wash the dishes

Lubisz zmywać naczynia?- Do you like washing dishes?

Zmywarka- Dishwasher

Jesteś dobrze zorganizowany- You are well organized

Twój dom jest czysty- Your house is clean

Kiedy byłeś mały lubiłeś sprzątać?- Did you like to clean when you were little?

Pedant, pedantka- Pedant, pedant

Znasz kogoś kto jest pedantem?- Do you know someone who's a pedantic?

Moje przeciwieństwo- My opposite

Napiszcie w komentarzach czy lubicie sprzątać i co- Write in the comments if you like cleaning and what

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we discussed Valentine's day

All Social Media + Donations https://linktr.ee/learnpolish

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

Correction - St Valentine was born in Italy and burried in Dublin, Ireland.

In this Episode we discuss:

Walentynki- Valentine's Day

Walentynki są popularne- Valentine's Day is popular

Czerwone serce- Red heart

Poduszka- Pillow

Serce to symbol Walentynek- The heart is a symbol of Valentine's Day

Zakochać się- Fall in love

Kiedy miałem 15 lat pierwszy raz się zakochałem- When I was 15 I fell in love for the first time

Jak miała na imię Twoja pierwsza miłość?- What was your first love's name?

Kochać- To love

Kocham moją żonę, chłopaka, syna- I love my wife, boyfriend, son

Umawiać się na randkę- To pick up a date

Chodzić na spotkania- To go to meetings

Być z kimś- To be with somebody

Związek- Relationship

Dawać prezenty- To give gifts

Mężczyźni kupują kobietom piękne czerwone róże- Men buy women beautiful red roses

Kartka Walentynkowa- Valentine's card

Ja Cię kocham tylko troszkę, jak kogucik swą kokoszkę- I love you only a little, like a cockerel his hen

Bądź moją Walentynką- Be my Valentine

Czy w Irlandii celebrujecie Walentynki?- Do you celebrate Valentine's Day in Ireland?

Masz siedem dni żeby kupić prezent dla swojej Walentynki- You have seven days to buy a gift for your Valentine

Napiszcie w komentarzach jak celebrujecie Walentynki- Write in the comments how you celebrate Valentine's Day-

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we discuss a conversation at the Dr's

All Social Media + Donations https://linktr.ee/learnpolish

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Lekarz- Doctor

Pacjent- Patient

Jak się Pan teraz czuje?- How do you feel now?

Nie za dobrze- Not so good

Chciałbym Pana zbadać- I would like to examine you

Proszę usiąść na stołku- Please sit on the stool

Tutaj?- Here?

Siostro, proszę pomóc pacjentowi rozebrać się- Sister, please help the patient to undress

Rozebrać się do pasa- Undress to the waist

Najpierw zbadam Pana gardło- First, I will examine your throat

Proszę otworzyć szeroko usta- Please open your mouth wide

Proszę powiedzieć „a”- Please say "a"

Proszę wyciągnąć język- Please pull out your tongue

Czy wszystko w porządku?- Is everything OK?

Gardło jest ładne- The throat is nice

Narzeka Pan na kaszel- You are complaining about a cough

Kaszel suchy czy mokry?- Dry or wet cough?

Proszę zakasłać- Please cough

Nic Pan nie odksztusza- You do not cough up notnhing

Kaszel mnie bardzo męczy- My cough tires me a lot

Często kaszlę- I often cough

Kiedy Pan najwięcej kaszle?- When do you cough the most?

W nocy, nie mogę spać, wciąż się budzę- At night, I can't sleep, I still wake up

Proszę usiąść prosto- Please sit up straight

Osłucham Pana- I will listen to you

Proszę głęboko oddychać- Please breathe deeply

Wdech i wydech- Inhale and exhale

Proszę wstrzymać oddech- Please hold your breath

Dziękuję, to wszystko- Thank you, that is all

Proszę się ubrać- Please dress up

Narzekać- Complain

Stetoskop- Stethoscope

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we discuss who works where.

All Social Media + Donations https://linktr.ee/learnpolish

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Umówić się na wizytę- To make an appointment

Zapisać się- Sign up

Chciałbym umówić się na wizytę do doktora- I would like to make an appointment with a doctor

Czy ma Pan swoją kartę?- Do you have your card?

Kiedy Panu pasuje przyjść?- When is it fit for you to come?

Co Panu dolega?- What is the problem?

Kaszel- Cough

Katar- Runny nose

Prywatny problem- Private problem

Musiałeś płacić za wizytę?- Did you have to pay for a visit?

Byłem prywatnie- I was privately

Czy wolisz chodzić do lekarza prywatnie czy do lekarza publicznego?- Do you prefer to go to the doctor privately or to the public doctor?

Kurkuma- Turmeric

Olej kokosowy- Coconut oil

Naturalne metody leczenia- Natural treatments

Antybiotyk zabija dobre bakterie- The antibiotic kills the good bacteria

Nie lubisz chodzić do lekarza- You don't like going to the doctor

Pijesz herbatę z miodem i cytryną- You drink tea with honey and lemon

Chusteczka higieniczna- Hygienic tissue

Ręcznik kuchenny- Kitchen towel

Lekarstwa- Medicine

Herbata z imbirem- Ginger tea

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we discuss who works where.

All Social Media + Donations https://linktr.ee/learnpolish

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Zawody- Professions

Kto pracuje w szkole?- Who works at school?

Nauczyciel, nauczycielka- Teacher

Kto pracuje w restauracji?- Who works in the restaurant?

Kelner, kelnerka- Waiter, waitress

Kucharz, kucharka- Cook

Kto pracuj w szpitalu?- Who work in the hospital?

Lekarz, lekarka-Doctor

Pielęgniarka, pielęgniarz- Nurse

Kto pracuje na wsi?- Who works in the countryside?

Rolnik- Farmer

Kto pracuje w sklepie?- Who works in the store?

Sprzedawczyni, sprzedawca- Saleswoman, seller

Kto ma swoją firmę?- Who has their own company?

Właściciel- Owner

Przedsiębiorca- Entrepreneur

Biznesmen- Businessman

Kto pracuje na poczcie?- Who works at the post office?

Listonosz- Postman

Kto jeździ autobusem, tramwajem, taksówką?- Who drives the bus, tram, taxi?

Kierowca- Driver

Kto robi zdjęcia?- Who is taking photos?

Fotograf- Photographer

Kto lubi tańczyć?- Who likes to dance?

Tancerz, tancerka- Dancer

Kto pracuje w telewizji?- Who works in television?

Aktorka, aktorka- Actress

Kto śpiewa na scenie, w operze, w teatrze?- Who sings on stage, in the opera, in the theater?

Piosenkarz, piosenkarka- Singer

Śpiewak, śpiewaczka- Singer

Kto pracuje w biurze rachunkowym?- Who works in the accounting office?

Kto pracuje w sądzie?- Who works in the court?

Prawnik, adwokat, sędzia- Lawyer, attorney, judge

Psycholog- Psychologist

Artysta- Artist

Dentysta, dentystka- Denstis

Piłkarz- Footballer

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we discuss different things to ask for in a tailors.

All Social Media + Donations https://linktr.ee/learnpolish

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UC9SeBSyrxEMtEUlQNjG3vTA

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Ostatni dzień tygodnia- Last day of the week

Niedziela- Sunday

Kalendarz- Calendar

Dzień Babci- Grandmother's day

Składać życzenia- To make wishes

Co możemy życzyć babci?- What can we wish grandma?

Kupujemy kwiaty- We buy flowers

Życzę Ci zdrowia, uśmiechu, dużo energii- I wish you health, a smile, a lot of energy

Dobre ciasto- Good cake

Okulary- Glasses

Robienie na drutach- Knitting

Bujać się na fotelu na biegunach- Rocking on a rocking chair

Babcia ma zawsze dużo słodyczy- Grandma always has a lot of sweets

Dzień Dziadka- Grandfather's day

Dziadek zawsze coś naprawia- Grandpa always fixes something

Chodzić do lasu na grzyby- To go to the forest for mushrooms

Dziadek pokazuje samochód- Grandpa shows the car

Z dziadkiem można łowić ryby- You can fish with your grandfather

Pamiętasz swojego dziadka?- Do you remember your grandfather?

Czy w waszym kraju jest takie święto?- Is there such a holiday in your country?

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

learnpolish #speakpolish #polishpodcast

View Details

Learn Polish in a fun way with short Episodes. On this episode we discuss different things to ask for in a tailors.

All Social Media + Donations https://linktr.ee/learnpolish

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UCk5CEEWZ2KgUTYJOTXNL8lQ

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Usługi- Services

Krawiec- Tailor

Kim jest krawiec?- Who is the tailor?

Idę do krawca- I'm going to the tailor

Byłem u krawca- I was at the tailor

Krawiec nie mówi po angielsku- The tailor does not speak English

W czym mogę pomóc?- How can I help you?

Za długie spodnie- Pants are too long

Skrócić nogawki- Shorten the legs

Urwał się guzik- The button has broken off

Pan chce przyszyć guzik- You want to sew on a button

Rozporek się zepsuł- The fly broke

Wstawić nowy rozporek- Insert a new fly

Zmniejszyć marynarkę- Reduce jacket

Poszerzyć spodnie- Widen pants

Zwęzić spodnie- Narrow pants

Za tydzień wszystko będzie gotowe- In a week everything will be ready

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

View Details

Learn Polish in a fun way with short Episodes. On the 100th Episode we talk about why I like Poland.

All Social Media + Donations https://linktr.ee/learnpolish

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UCk5CEEWZ2KgUTYJOTXNL8lQ

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Wyjątkowy dzień- A special day

O Polsce- About Poland

Lubię Polsce bo w Polsce jest piękne morze- I like Poland because Poland has a beautiful sea

Morze Bałtyckie- Baltic Sea

Pierogi- Dumplings

Pyszne jedzenie- Delicious food

Piękne miasto Gdańsk- Beautiful city Gdańsk

Trójmiasto- Tri-City

Kraków jest pięknym miastem- Krakow is a beautiful city

Stare miasto- Old Town

Dużo zabytków- A lot of monuments

Piękna architektura- Beautiful architecture

Dużo turystów- Lots of tourists

Dobre piwo- Good beer

W Polsce są piękne kobiety- There are beautiful women in Poland

Niebieskie oczy- Blue eyes

Jasna karnacja- Light complexion

Molo w Sopocie- The Sopot molo

Piękne góry Tatry- Beautiful Tatra Mountains

Piękne jeziora- Beautiful lakes

Mazury- Masuria

Polska jest nowoczesna- Poland is modern

W Polsce jest dużo atrakcji- There are many attractions in Poland

Język polski jest piękny- The Polish language is beautiful

Napiszcie w komentarzach, lubię Polskę bo… - Write in the comments, I like Poland because ...

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

View Details

Learn Polish in a fun way with short Episodes. This lesson we talk about tastes, shapes and colours

All Social Media + Donations https://linktr.ee/learnpolish

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UCk5CEEWZ2KgUTYJOTXNL8lQ

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Usługi- Services

Z jakich usług korzystasz?- What services do you use?

Warsztat samochodowy- Service station

Fryzjer- Hairdresser

Kosmetyczka- Beautician

Krawiec- Tailor

Szewc- Shoemaker

Poczta- Post office

Jak często chodzisz do fryzjera?- How often do you go to the hairdresser?

Jak często jeździsz do warsztatu?- How often do you go to the service station?

Czy chodziłeś do szewca?- Did you go to the shoemaker?

Cały dzień jesteś w butach- You're in shoes all day

Ubezpieczenia- Insurance

Chodzisz na pocztę?- Do you go to the post office?

Chodzisz do kosmetyczki?- Do you go to the beautician?

Czy Wy korzystacie z usług?- Do you use the services?

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

View Details

Learn Polish in a fun way with short Episodes. This lesson we talk about tastes, shapes and colours

All Social Media + Donations https://linktr.ee/learnpolish

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UCk5CEEWZ2KgUTYJOTXNL8lQ

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Smak- Taste

Kształt- Shape

Kolor- Colour

Jakie znasz smaki?- What flavors do you know?

Gorzki- Bitter

Słodki- Sweet

Ostry- Spicy

Kwaśny- Sour

Okrągły- Round

Owalny- Oval

Podłużny- Longitudinal

Kwadratowy- Square

Trójkątny- Triangular

Czarny- Black

Biały- White

Niebieski- Blue

Brązowy- Brown

Fioletowy- Purple

Jaki smak ma cytryna?- How does lemon taste?

Cytryna jest kwaśna- Lemon is sour

Jaka jest malina?- What is raspberry?

Malina jest słodka- Raspberry is sweet

Jaki smak ma papryczka chili?- What is the flavor of chili pepper?

Jaki smak ma kiwi?- What is the flavor of the kiwi?

Jaki kształt ma jabłko?- What is the shape of an apple?

Jaki kształt ma ogórek?- What shape is a cucumber?

Jaki kształt ma gruszka?- What is the shape of a pear?

Gruszka może być żółta- Pear may be yellow

Brokuł- Broccoli

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

View Details

Learn Polish in a fun way with short Episodes. This lesson we talk about winter holidays.

All Social Media + Donations https://linktr.ee/learnpolish

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UCk5CEEWZ2KgUTYJOTXNL8lQ

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Pechowy dzień- Unlucky day

Pech- Bad luck

Mam pecha- I have bad luck

Kiedy dzień jest pechowy?- When is the day unlucky?

Zaspałem- I overslept

Możemy zaspać- We can oversleep

Zapomniałem nastawić budzik- I forgot to set the alarm clock

Spóźnić się- To be late

Nie miałem czasu wypić herbaty- I didn't have time to drink my tea

Wycieraczki się zepsuły- The wipers broke

Tramwaj odjechał- The tram departed

Nabić sobie guza- To get a tumor

Zapłacić dużo pieniędzy za taksówkę- To pay a lot of money for a taxi

Zgubić klucze do domu- To lost house keys

Złodziej- Robber

Nie mam dokumentów- I have no documents

Spędzić noc w areszcie- To spend the night in custody

To był tylko straszny sen- It was just a terrible dream

Przewrócić się- To fall over

Uderzyć się w głowę- To hit your head

Zostawić portfel w taksówce- To leave a wallet in the taxi

Być zwolnionym z pracy- To be fired

Zostać aresztowanym- To get arrested

Czy wy mieliście ostatnio pechowy dzień?- Have you had an unlucky day lately?

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

View Details

Learn Polish in a fun way with short Episodes. This lesson we talk about winter holidays.

All Social Media + Donations https://linktr.ee/learnpolish

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UCk5CEEWZ2KgUTYJOTXNL8lQ

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Sylwester- New Years Eve

Nowy rok- New Year

Trzymam kciuki- I keep fingers crossed

Styczeń, pierwszy miesiąc- January, first month

Luty- February

Ferie zimowe- Winter holidays

W styczniu albo w lutym były ferie zimowe- In January or February it was winter holidays

Co można robić w ferie zimowe?- What can we do during the winter holidays?

Możemy jechać w góry- We can go to the mountains

Jak się nazywają się polskie góry?- What are the Polish mountains called?

Tatry to polskie góry- The Tatras are Polish mountains

Co możemy robić górach?- What can we do in the mountains?

Możemy jeździć na nartach- We can ski

Masz narty w domu?- Do you have skis at home?

Byłem w Austrii i we Włoszech- I have been to Austria and Italy

Byłeś w Zakopanem?- Have you been to Zakopane?

W Irlandii nie ma śniegu- There is no snow in Ireland

Nie mam planów- I have no plans

Jeździć na snowboardzie- Snowboarding

Za oknem nie ma śniegu- There is no snow outside the window

Bałwan- Snowman

Rzucać się śnieżkami- To snowfight

Czy w waszym kraju jest teraz śnieg?- Is there snow in your country now?

Czy macie ferie zimowe?- Do you have winter holidays?

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

View Details

Learn Polish in a fun way with short Episodes

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UCk5CEEWZ2KgUTYJOTXNL8lQ

All Social Media https://linktr.ee/learnpolish

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Piję kawę- I am drinking coffee

Nie jadłem śniadania- I didn't eat breakfast

Na czczo- On an empty stomach

Syrop klonowy- Maple syrup

Stary rok- Old year

Jaki był ten rok?- How was this year?

Bilans starego roku- Balance of the old year

Osiągnięcia w starym roku- Achievements in the old year

Robiłem nowy podcast- I was making a new podcast

Organizowałem nowy biznes- I was organizing a new business

Zacząć nową platformę- To start a new platform

Prywatne sukcesy- Private successes

Kupiłem gitarę- I bought a guitar

Dobry czas z moim synem- Good time with my son

Dużo ćwiczyłem latem- I exercised a lot in the summer

To był dobry rok- It was a good year

Czego żałujesz i co byś zmienił?- What do you regret and what would you change?

Kaszel- Cough

Maska jest dobra kiedy ktoś jest chory- A mask is good when someone is sick

Pogoda jest dobra- The weather is good

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

View Details

Learn Polish in a fun way with short Episodes

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UCk5CEEWZ2KgUTYJOTXNL8lQ

All Social Media https://linktr.ee/learnpolish

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Poranek- Morning

Życzenia noworoczne- New Year's wishes

Koniec starego roku- End of the old year

Sylwester- New Year’s Eve

Jakie masz plany na sylwestra?- What are your plans for New Year's Eve?

Będziemy bawić się z moim synem- We will play with my son

Wolność- Freedom

Miły wieczór- Nice evening

Północ- Midnight

Otwierać szampana- To open a champagne

Jakie życzenia?- What wishes?

Szczęśliwego nowego roku- Happy New Year

Milenium - Millennium

Jakie masz plany na nowy rok?- What are your plans for the new year?

Publikować książki- To publish books

Sprzedawać książki- To sell books

Więcej słuchaczy- More listeners

Dziennikarze- Journalists

Poważne plany- Serious plans

Powodzenia- Good luck

Plany duchowe- Spiritual plans

Plany zdrowotne- Health plans

Uprawiać więcej sportu- Do more sports

Zmienić dietę- To change diet

Nie kupować jedzenia w puszcze- Do not buy food in a can

Trzymać kciuki- To keep our fingers crossed

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

View Details

Learn Polish in a fun way with short Episodes

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UCk5CEEWZ2KgUTYJOTXNL8lQ

All Social Media https://linktr.ee/learnpolish

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Piękna bluzka- Beautiful blouse

Kwiaty- Flowers

Ja mam katar- I have a runny nose

Zapraszanie na spotkanie- Inviting to a meeting

Zapraszać- To invite

Ja zapraszam- I invite

Ty zapraszasz- You invite

On zaprasza- He invites

My zapraszamy- We invite

Wy zapraszacie- You invite

Oni zapraszają- They invite

Kogo zapraszasz?- Who are you inviting?

Zapraszam Cię- I invite you

Zapraszam Panią- I invite You

Zapraszam Pana- I invite You

Zapraszam Cię na obiad- I invite you to a dinner

Zapraszam Cię na kolację- I invite you to a supper

Zapraszam Cię na lody- I invite you for ice cream

Zapraszam Cię na randkę- I invite you on a date

Zapraszam Cię na świąteczny obiad- I invite you to Christmas dinner

Zapraszam Cię na sylwestra- I invite you to New Year's Eve

Zapraszam Cię na kawę do kawiarni- I invite you for a coffee in the cafe

Zapraszam Cię do teatru- I invite you to a theater

Zapraszam Cię na kolację do restauracji- I invite you to dinner at the restaurant

Umawiać się na spotkanie- To arrange a meeting

Zapraszam Cię na film do kina- I invite you to a movie to the cinema

O której godzinie?- At what time?

Gdzie się spotkamy?- Where are we going to meet?

Zapraszam Cię na śniadanie do nowej, wegetariańskiej restauracji- I invite you to breakfast in the new vegetarian restaurant

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

View Details

Learn Polish in a fun way with short Episodes

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UCk5CEEWZ2KgUTYJOTXNL8lQ

All Social Media https://linktr.ee/learnpolish

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Rezerwować stolik w restauracji- To book a table in a restaurant-

Wszystko jest zajęte- Everything is occupated

Chciałbym zarezerwować stoik dla dwóch osób- I would like to book a table for two people

Dla trzech osób- For three people

Dla czterech osób- For four people

Kelnerka- Waitress

Restauracja włoska- Italian restaurant

Czwartek wieczorem- Thursday evening

Zobaczę czy mamy wolne miejsca- I'll see if we have any free places

Piękny stolik przy oknie- Lovely table by the window

Daleko od toalety- Far from the toilet

Rezerwacja jest gotowa- Reservation is ready

Kino- Cinema

Chciałbym zarezerwować bilet- I would like to book a ticket

Bilet normalny czy ulgowy?- Normal or reduced ticket?

Ostatni seans jest o 21:20- The last screening is at 21: 20

Który rząd?- Which row?

Ostatni rząd- Last row

Na środku- In the middle

Ile kosztuje bilet?- How much is the ticket?

Będę płacić kartą- I will pay by card

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

Practice Makes Perfect :)

View Details

Learn Polish in a fun way with short Episodes

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UCk5CEEWZ2KgUTYJOTXNL8lQ

All Social Media https://linktr.ee/learnpolish

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Przemawiać na scenie- To speak on stage

Pomagać ludziom- To help people

Prawo jazdy- Driving license

Kierowca- Driver

Czy ty jesteś kierowcą?- Are you the driver?

Jakim kierowcą jesteś?- What kind of driver are you?

Wszyscy mówią, że jesteś dobrym kierowcą- Everyone says you're a good driver

Ile lat masz prawo jazdy?- How many years do you have a driving license

Miałem osiemnaście lat- I was eighteen

Mam prawo jazdy trzydzieści lat- I have a driving license for thirty years

Ile miałeś samochodów?- How many cars have you had?

Wsiadać do samochodu- To get in the car

Zapinamy pasy- We fasten seat belts

Opalamy silnik- We heat the engine

Prowadzić samochód- To driver a car

Czy Ty lubisz prowadzić samochód?- Do you like driving a car?

Ty decydujesz jaka będzie muzyka- You decide what the music will be

Gdzie zwykle jeździsz?- Where do you usually go?

Gdzie pojechałeś najdalej?- Where did you go the farthest?

Byłem w Estonii i w Chorwacji- I have been to Estonia and Croatia

Ile godzin jechałeś do Estonii?- How many hours did you drive to Estonia?

Do Chorwacji jechałem czternaście godzin- I drove to Croatia fourteen hours

Potrzebujemy nawigację- We need navigation

Jedź prosto- Drive straight

Skręć w lewo/w prawo- Turn left / right

Zawróć- Turn around

Migacze- Blinkers

Skrzynia biegów-Transmission

Biegi- Gears

Przyspieszenie- Acceleration

Hamulec- Brake

Hamulec ręczny- Hand brake

Sprzęgło- Clutch

Kierownica- Steering wheel

Lusterka- Mirrors

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

Practice Makes Perfect :)

View Details

Learn Polish in a fun way with short Episodes

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UCk5CEEWZ2KgUTYJOTXNL8lQ

All Social Media https://linktr.ee/learnpolish

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Niedziela- Sunday

Co robisz w niedzielę?- What are you doing on Sunday?

Pracoholik- Workaholic

Czasowniki modalne- Modal verbs

Musieć- Must/Have to

Chcieć- Want

Móc- Can

Ja muszę- I must

Ty musisz- You must

Co musisz robić?- What do you have to do?

Muszę robić podcasty z Tobą- I must to make podcasts with you

Jakie masz obowiązki?- What are your duties?

Muszę pracować- I have to work

Muszę sprzątać dom- I have to clean the house

Muszę prasować ubrania- I have to iron my clothes

Muszę płacić podatki- I have to pay taxes

Muszę bawić się z moim synem- I have to play with my son

Co Wy musicie robić?- What do you have to do?

Ja chcę- I want

Ty chcesz- You want

Co chcesz robić?- What do you want to do?

Ja chcę być zdrowy- I want to be healthy

Chcę czytać- I want to read

Ja mogę- I can

Ty możesz- You can

Ja mogę edytować podcast- I can edit a podcast

Czy mogę otworzyć okno?- Can I open the window?

Możesz robić tysiąc podcastów- You can make a thousand of podcasts

Nie mogę iść do restauracji- I can't go to the restaurant

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

Practice Makes Perfect :)

polish #polishlesson #polishpodcast

View Details

Learn Polish in a fun way with short Episodes

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UCk5CEEWZ2KgUTYJOTXNL8lQ

All Social Media https://linktr.ee/learnpolish

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Choinka- Christmas tree

Masz choinkę w domu?- Do you have a Christmas tree at home?

Moja choinka jest mniejsza- My Christmas tree is smaller

Dekoracje- Decor

Bombki- Christmas balls

Czubek choinki- Christmas tree top

Gwiazda- Star

Światełka- Lights

Aniołek- Angel

Mały aniołek- Little angel

Duży anioł- Big angel

Pierniczek- Gingerbread

Ciasteczka- Cookies

Co jest pod choinką?- What's under the Christmas tree?

Prezent dla mnie- Gift for me

Skarpeta- Sock

Nie ma prezentu- There is no gift

Święty Mikołaj będzie pamiętał o Tobie- Santa Claus will remember about you

Prezent od wujka- Gift from uncle

Święto Trzech Króli- Epiphany

Renifer- Reindeer

Czerwony nos- Red nose

Bałwan- Snowman

Lepić bałwana- Make a snowman

Śnieżynka- Snowflake

Szalik- Scarf

Nos z marchewki- Carrot nose

Lubisz świece?- Do you like candles?

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

Practice Makes Perfect :)

polish #polishlesson #polishpodcast

View Details

Learn Polish in a fun way with short Episodes

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UCk5CEEWZ2KgUTYJOTXNL8lQ

All Social Media https://linktr.ee/learnpolish

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Masz nową koszulę- You have a new shirt

Szósty grudnia- December 6th

Mikołajki- Santa Claus Day

Ludzie kupują prezenty- People buy gifts

Wszyscy lubią prezenty- Everyone likes gifts

Jaki rozmiar koszuli?- What shirt size?

Siłownie są zamknięte- Gyms are closed

Lubisz dostawać ubrania?- Do you like getting clothes?

Masz bardzo dużo książek- You have a lot of books

Książki polityczne, historyczne- Political and historical books

Nie kupiłeś żadnych prezentów- You didn't buy any gifts

Święta Bożego Narodzenia- Christmas

Symbole- Symbols

Kiedy są święta w Irlandii?- When are holidays in Ireland?

Wigilia- Christmas Eve

Lubisz święta w Polsce?- Do you like Christmas in Poland?

Polskie tradycyjne potrawy- Polish traditional dishes

Wolę indyka- I prefer turkey

Czy w Irlandii ubieracie choinkę?- Do you decorate a Christmas tree in Ireland?

Czy w waszym kraju obchodzicie Mikołajki? - Do you celebrate Santa Claus Day in your country?

Czy dajecie sobie prezenty?- Do you give each other gifts?

Jakie prezenty?- What gifts?

Niedrogie, symboliczne prezenty- Inexpensive, symbolic gifts

If you would like Skype lessons from kamila or her team please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

View Details

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UCk5CEEWZ2KgUTYJOTXNL8lQ

All Social Media https://linktr.ee/learnpolish

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Późna godzina- Late hour

Dobry wieczór- Good evening

Polski alfabet- Polish alphabet

A ,aparat- Camera

Ą, oni są- They are

B, bank- Bank

C, cebula- Onion

Ć, ćma- Moth

D,dom- House

E,ekran- Screen

Ę, język- Language

F, fioletowy- Purple

G, gruszka- Pear

H, herbata- Tea

I, indyk- Turkey

J, jabłko- Apple

K, kangur- Kangaroo

L, lalka- Doll

Ł, ławka- Bench

M, malina- Raspberry

N, nektarynka- Nectarine

Ń, koń- Horse

O, ogórek- Cucumber

Ó, góra- Mountain

P, Polska- Poland

R, rower- Bicycle

S, student- Student

Ś, śliwka- Plum

T, tata- Father

U, ulica- Street

W, woda- Water

Y, tygrys- Tiger

Z, zebra- Zebra

Ź, źrebak- Foal

Ż, żaba- Frog

Słońce- Sun

Gwiazdy- Stars

Dom- House

Lampa- Lamp

Polski alfabet to bułka z masłem- The Polish alphabet is a piece of cake

Stół- Table

Wanna - Bath

Woda- Water

Łóżko- Bed

Koc- Blanket

If you would like Skype lessons from kamila please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

View Details

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UCk5CEEWZ2KgUTYJOTXNL8lQ

All Social Media https://linktr.ee/learnpolish

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Dzisiaj padał śnieg- It was snowing today

Lubisz śnieg?- Do you like snow?

Jest bardzo zimno- It is very cold

Lubisz zimę?- Do You like winter?

Wolisz lato- You prefer summer

Polskie idiomy- Polish idioms

Bułka z masłem (coś jest bardzo łatwe)- Piece of cake (something is very easy)

Język polski to bułka z masłem- Polish is a piece of cake

Czytanie książki to bułka z masłem- Reading a book is a piece of cake

Urwanie głowy (mam bardzo dużo pracy, nie mam czasu)- I have my head off (I have a lot of work, I don't have time) -

Jesteś bardzo zajęty, masz urwanie głowy- You are very busy, you have your head of

Flaki z olejem- Tripe with oil

Coś jest nudne jak flaki z olejem- Something is boring like tripe with oil

Plotkowanie jest nudne jak flaki z olejem- Gossiping is boring as tripe with oil

Mecz w telewizji jest nudny jak flaki z olejem- The match on TV is boring as tripe with oil

Ręce opadają (nie wiem co robić, nie mam pomysłu)- Hands drop (I don't know what to do, I have no idea)

Kiedy Wam opadają ręce?- When are your hands dropping?

Co jest dla Was nudne jak flaki z olejem? - What's boring for you as tripe with oil?

Kiedy macie urwanie głowy?- When are you getting your head off?

Co jest dla was bułką z masłem?- What's a piece of cake for you?

If you would like Skype lessons from kamila please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

View Details

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UCk5CEEWZ2KgUTYJOTXNL8lQ

All Social Media https://linktr.ee/learnpolish

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Brzydkie słowa- Bad words

Kurde- Damm

Kurcze- Damm

Kiedyś jesteś zdenerwowany, mówisz o kurcze- When you are nervous, you say damm it

Cholera- Holly shit

Do jasnej cholery- Goddamn it

Spadaj- Go away

Spadaj, nie chcę z Tobą rozmawiać- Go away, I do not want to talk with you

Idź do diabła- Go to hell

Coś jest do dupy – Something is not good (Something sucks)

Mam to w dupie- I do not care (I don't give a shit)

Używasz brzydkich słów?- Do you use bad words?

Nigdy nie używać brzydkich słów- Never use bad words

If you would like Skype lessons from kamila please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

View Details

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UCk5CEEWZ2KgUTYJOTXNL8lQ

All Social Media https://linktr.ee/learnpolish

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Co to jest?- What is this?

To jest gitara- This is a guitar

Umiesz grać na gitarze?- Can you play the guitar?

Ja umiem grać- I can play

Ja umiem- I can

Ty umiesz- You can

On, ona ,ono umie- He, she, it can

My umiemy- We can

Wy umiecie- You can

Oni, one umieją- They can

Nie masz talentu- You have no talent

Grać na pianinie- To play the piano

Mój brat umie grać na pianinie- My brother can play the piano

Na czym umiesz grać?- What can you play?

Ty umiesz grać na nerwach- You can play on the nerves

Jestem specjalistą- I am a specialist

Czy umiesz grać na gitarze?- Can you play guitar?

Trochę- A little bit

Podoba mi się jak grasz na gitarze- I like the way you play guitar

Grać na bębenku- To play the drum

Uczę się grać na bębenku- I'm learning to play the drum

Perkusja- Drums

Można grać na skrzypcach- You can play the violin

Można grać na flecie- You can play the flute

Można grać na pianinie- You can play the piano

Można grać na harmonijce- You can play the harmonica

Iść na kurs- To go on a course

Trzymam kciuki- I keep my fingers crossed

Życzę powodzenia- Good luck

If you would like Skype lessons from kamila please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

View Details

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UCk5CEEWZ2KgUTYJOTXNL8lQ

All Social Media https://linktr.ee/learnpolish

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Jak było w Afryce?- How was in Africa?

Wspaniale- Great

Widziałem słonie, tygrysy, żyrafy, lwy- I saw elephants, tigers, giraffes, lions

Hipopotamy w rzece- Hippos in the river

Zwierzęta egzotyczne- Exotic animals

Lew- Lion

Polecam ten hotel- I recommend this hotel

Piękny basen- Lovely pool

Pięć gwiazdek- Five stars

Pyszne jedzenie- Delicious food

Co jadłeś?- What did you eat?

Lokalne jedzenie- Local food

Jaka była pogoda?- What was the weather?

Świeciło słońce- The sun was shining

Ludzie bardzo sympatyczni- Very nice people

Dużo turystów- Lots of tourists

Byłeś na pustyni?- Were you in the desert?

Wielbłąd- Camel

Masz jakieś zdjęcia?- Do you have any photos?

Reportaż z Afryki- Report from Africa

If you would like Skype lessons from kamila please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

View Details

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on

Bitchute https://www.bitchute.com/channel/pxb8OvSYf4w9/

Youtube https://www.youtube.com/channel/UCk5CEEWZ2KgUTYJOTXNL8lQ

All Social Media https://linktr.ee/learnpolish

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Róże- Roses

Żółte róże- Yellow roses

Ogród- Garden

Mam kwiaty w ogrodzie- I have flowers in the garden

Latem jest dużo kwiatów- There are a lot of flowers in summer

Biuro podróży- Travel agency

Najlepsze wakacje- Best holiday

Wycieczka do Grecji- Trip to Greece

Afryka- Africa

Ile kosztuje ta wycieczka?- How much does it cost this trip?

Ta wycieczka kosztuje 2000 PLN- This trip costs 2000 PLN

Na jak długo?- For how long?

Jaki jest termin wycieczki?- What is the date of the trip?

Tylko siedem dni- Only seven days

Dwa tygodnie kosztują 3500 PLN- Two weeks costs 3500 PLN

Z którego lotniska jest wylot?- Which airport does it depart from?

Z lotniska w Łodzi- From the airport in Łódź

Co zawiera cena?- What's included in the price?

Cena zawiera ubezpieczenie, pełne wyżywienie- The price includes insurance, full board

Trzy wycieczki fakultatywne- Three optional trips

Zakwaterowanie- Accommodation

Ekskluzywny hotel- Exclusive hotel

Czy cena zawiera alkohole?- Does the price include alcohol?

Czy można wziąć ze sobą zwierzęta?- Can I take pets with me?

Pan będzie podróżował bez zwierząt- You will travel without animals

Czy dzieci mają wycieczkę gratis?- Do the children have a free trip?

Dzieci płacą pół ceny- Children pay half of the price

Szczepionka- Vaccine

Atrakcje turystyczne, zabytki, pustynia- Tourist attractions, monuments, desert

Życzę udanych wakacji- I wish you a good holiday

If you would like Skype lessons from kamila please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

View Details

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on Youtube https://www.youtube.com/channel/UCk5CEEWZ2KgUTYJOTXNL8lQ

All Social Media https://linktr.ee/learnpolish

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Podcasty- Podcasts

Porozmawiamy o podcastach- We will talk about podcasts

Skąd pomysł żeby robić podcasty?- Where did the idea to make podcasts come from?

Byłem na konferencji- I was at the conference

To dobry pomysł- It's a good idea

Wywiad- Interview

Wywiad z interesującymi osobami- Interview with interesting people

Kwalifikacje żeby dobrze mówić- Qualifications to speak well

Kurs jak lepiej mówić- A course on how to speak better

Ile masz podcastów?- How many podcasts do you have?

Jakie tematy?- What topics?

Język polski- Polish language

Medytacja- Meditation

Bardzo krótka medytacja- A very short meditation

Przebudzenie- Awakening

Jak może być lepiej?- How could it be better?

Musisz wiedzieć- You must know

Cały czas pracujesz- You work all the time

To jest Twoje hobby- This is your hobby

Spotykam interesujących ludzi- I meet interesting people

Jak często robisz podcasty?- How often do you make podcasts?

Dwa razy w tygodniu- Twice a week

Medytacja jest nieregularna- Meditation is irregular

Rocznica- Anniversary

Dużo szczęścia i powodzenia- Lots of luck and good luck

Który podcast lubisz najbardziej?- Which podcast do you like the most?

If you would like Skype lessons from kamila please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

View Details

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on Youtube https://www.youtube.com/channel/UCk5CEEWZ2KgUTYJOTXNL8lQ

All Social Media https://linktr.ee/learnpolish

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Polska gramatyka- Polish grammar

Konkurs- Competition

Pytanie ze słowem „czym”- Question with the word "czym"

Czym się interesujesz?- What are you interested in?

Interesuje się podcastami, czytaniem, squashem- I am interested in podcasts, reading, squash

Czy się zajmujesz?- What do you deal with?

Zajmuję się podcastami- I deal with podcasts

Zajmuję się domem- I deal with house

Zajmuję się ogrodem- I deal with garden

Czym jedziesz do pracy?- How are you going to work?

Jadę samochodem- I am going by car

Czym piszesz?- What do you write with?

Piszę długopisem- I write with a pen

Czym malujesz?- What do you paint with?

Maluję kredkami- I paint with colored pencils

Czym myjesz ręce?- What do you wash your hands with?

Myję ręce mydłem- I wash my hands with soap

Czym myjesz naczynia?- What do you wash the dishes with?

Myję naczynia płynem- I wash the dishes with liquid

Czym myjesz włosy?- What do you wash your hair with?

Włosy myję szamponem- I wash my hair with shampoo

Czym myjesz zęby?- What do you brush your teeth with?

Zęby myję pastą do zębów- I brush my teeth with toothpaste

Czym pachniesz?- How do you smell like?

Pachnę perfumami- I smell like perfume

Czym się golisz?- What do you shave with?

Golę się maszynką- I shave with a razor

Czym obcinamy włosy?- What do we cut our hair with?

Obcinamy włosy nożyczkami- We cut the hair with scissors

If you would like Skype lessons from kamila please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

View Details

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on Youtube https://www.youtube.com/channel/UCk5CEEWZ2KgUTYJOTXNL8lQ

All Social Media https://linktr.ee/learnpolish

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Uśmiechnięty jak banan- Smiling like a banana

Polecenie- Command

Co nauczycielka mówiła?- What did the teacher say?

Nie mów- Do not speak

Siedź- Sit

Stój- Stand

Pisz- Write

Czytaj- Read

Jedz- Eat

Pij- Drink

Patrz- Look

Oglądaj- Watch

Słuchaj- Listen

Co mówisz do syna?- What are you saying to the son?

Sprzątaj- Clean

Umyj-Wash

Umyj zęby- Brush your teeth

Weź prysznic- Take a shower

Wykąp się- Take a bath

Ubierz się- Get dressed

Przytul mnie- Hug me

Daj buziaka- Give me a kiss

Co mówisz do pracownika?- What are you saying to the employee?

Napisz artykuł- Write an article

Proszę artykuł- Article please

Co mówi mąż do żony?- What does the husband say to his wife?

Daj mi obiad- Give me a dinner

Ucz się polskiego- Learn Polish

If you would like Skype lessons from kamila please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

View Details

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on Youtube https://www.youtube.com/channel/UCk5CEEWZ2KgUTYJOTXNL8lQ

All Social Media https://linktr.ee/learnpolish

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Dzień Wszystkich Świętych- All Saints Day

Brzydka pogoda- Bad weather

Smutny dzień- A sad day

Ludzie idą na cmentarz- People go to the cemetery

Znicze- Candles

Kwiaty- Flowers

Czy Ty chodzisz na cmentarz?- Do you go to the cemetery?

Babcia- Grandmother

Babcia nie żyje pięć lat- Grandma has died five years ago

Czy Twój dziadek żyje?- Is your grandfather alive?

Wspominać rodzinę- To remember the family

Jaka była Twoja babcia?- What was your grandmother like?

Ona miała dziewięćdziesiąt sześć lat- She was ninety six years old

Nie pamiętam mojego dziadka- I don't remember my grandfather

Bliska rodzina- Close family

Wszyscy są w domu- Everybody's home

Iść na cmentarz- To go to the cemetery

Kupić kwiaty- To buy flowers

Zapalić znicz- To light a candle

Wspominać bliskich- To remember loved ones

Czy macie w swoim kraju Święto Zmarłych?- Do you have All Saints Day in your country?

If you would like Skype lessons from kamila please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

View Details

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on Youtube https://www.youtube.com/channel/UCk5CEEWZ2KgUTYJOTXNL8lQ

All Social Media https://linktr.ee/learnpolish

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Wieczór- Evening

Co robisz wieczorem?- What are you doing tonight?

Pracowity wieczór- Busy evening

Relaksujący wieczór- Relaxing evening

Ładny kubek-Nice mug

Lubisz herbatę?- Do you like tea?

Herbata w torebkach- Tea in bags

Herbata owocowa- Fruit tea

Czarna herbata- Black tea

Zielona herbata- Green tea

Czerwona herbata- Red tea

Malinowa herbata- Raspberry tea

Truskawkowa herbata- Strawberry tea

Lubisz zioła?- Do you like herbs?

Jakie zioła lubisz?- What herbs do you like?

Mięta- Mint

Rumianek- Camomile

Lubię pić miętę i rumianek- I like to drink mint and camomile

Z czym może być herbata?- What can tea be with?

Herbata z cytryną- Tea with lemon

Herbata z miodem- Tea with honey

Herbata z mlekiem- Tea with milk

Herbata ze stewią- Tea with stevia

Brązowy cukier- Brown sugar

Bez cukru- Without sugar

Może chcesz się napić herbaty?- Maybe you want to drink a tea?

Ile herbaty dziennie pijesz?- How much tea do you drink daily?

Piję jedną herbatę dziennie- I drink one tea a day

Jaką wy herbatę lubicie?- What kind of tea do you like?

If you would like Skype lessons from kamila please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

View Details

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on Youtube https://www.youtube.com/channel/UCk5CEEWZ2KgUTYJOTXNL8lQ

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Co jutro będę gotować na obiad?- What will I cook for dinner tomorrow?

Jaką zupę lubisz?- What kind of soup do you like?

Żurek- Sour soup

Lubię zupę grzybową- I like mushroom soup

Lubisz zupę ogórkową?- Do you like cucumber soup?

Jak zrobić rosół wegetariański?- How to make a vegetarian chicken soup?

Bulion warzywny w kostkach- Vegetable stock cubes

Czego potrzebujemy?- What do we need?

Warzywa- Vegetables

Seler- Celery

Por- Por

Marchew- Carrot

Pietruszka- Parsley

Garnek- Pot

Nalewamy wodę do garnka- We pour water into the pot

Obieramy warzywa- We peel vegetables

Umyć warzywa- To wash vegetables

Pokroić marchewkę- To cut the carrot

Wkładamy warzywa do garnka- We put the vegetables into the pot

Gotujemy- We cook

Cebula- Onion

Dodać sól i pierz- To add salt and pepper

Liść laurowy- Bay leaf

Ziele angielskie- Allspice

Jak długo gotujemy?- How long do we cook?

Drugi garnek- Second pot

Makaron- Pasta

Gotujemy makaron trzy minuty- We cook the pasta for three minutes

Mam wszystkie składniki- I have all the ingredients

If you would like Skype lessons from kamila please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

View Details

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on Youtube as Audio only https://www.youtube.com/channel/UCk5CEEWZ2KgUTYJOTXNL8lQ

New Awakening Podcast just released http://awakeningpodcast.org/

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Ilość- Quantity

Kilogram- Kilogram

Proszę kilogram cukru- Please (Can I have) a kilogram of sugar

Kilogram soli- Kilogram of salt

Kilogram mąki- Kilogram of flour

Kilogram ryżu- Kilogram of rice

Pół kilo pomidorów- Half a kilogram of tomatoes

Pół kilo jabłek- Half a kilogram of apples

Paczka papierosów- Pack of cigarettes

Paczka herbaty- Pack of tea

Paczka chipsów- Pack of chips

Kawałek pizzy- Slice of pizza

Kawałek ciasta- A piece of cake

Plasterek sera- Slice of cheese

Plasterek szynki- Slice of ham

Słoik miodu- Jar of honey

Słoik dżemu- Jar of jam

Słoik ogórków- Jar of cucumbers

Puszka coli- Can of cola

Puszka piwa- Can of beer

Puszka kukurydzy- Can of corn

Puszka orzeszków- Can of peanuts

Butelka piwa- Bottle of beer

Butelka wody- Bottle of water

Butelka soku- Bottle of juice

Pudełko ciastek- Box of cookies

Pudełko kawy- Box of coffee

Bochenek chleba- Loaf of bread

Kostka masła- Cube of butter

Kostka czekolady- Cube of chocolate

Kostka mydła- Bar of soap

Szklanka herbaty- A glass of tea

Szklanka wody- A glass of water

Filiżanka kawy- A cup of coffee

Kieliszek wódki- A glass of vodka

Talerz zupy- A bowl of soup

If you would like Skype lessons from kamila please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

View Details

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on Youtube as Audio only https://www.youtube.com/channel/UCk5CEEWZ2KgUTYJOTXNL8lQ

New Awakening Podcast just released http://awakeningpodcast.org/

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Jedzenie- Food

Jeść- To eat

Lubisz jeść?- Do you like to eat?

Jakie jedzenie lubisz?- What food do you like?

Lubisz różne jedzenie- You like different food

Jajka- Eggs

Zupa pomidorowa- Tomato soup

Zupa jest dobra- The soup is good

Zupa jest smaczna- The soup is tasty

Wyśmienita- Delicious

Zupa jest taka sobie- The soup is so-so

Zupa jest niezła- The soup is not bad

Zupa jest niedobra- The soup is not good

Zupa jest niesmaczna- The soup is tasteless

Zupa jest fatalna- The soup is terrible

Co dzisiaj gotowałeś?- What did you cook today?

Jak smakuje wegetariańska kiełbasa?- What does vegetarian sausage taste like?

Ja dzisiaj jadłam kanapkę z pomidorem- I ate a tomato sandwich today

Kanapka z pomidorem była pyszna- The tomato sandwich was delicious

Najlepsze jedzenie jakie jadłeś- The best food you've eaten

Kaczka z ziemniakami- Duck with potatoes

Potrawa jest wyśmienita- The dish is delicious

Najgorsze jedzenie- The worst food

Pierogi- Dumplings

Pierogi z grzybami- Dumplings with mushrooms

Pierogi z serem- Dumplings with cottage cheese

Pierogi z truskawkami- Dumplings with strawberries

Mąka- Flour

Co wy dzisiaj jedliście? Jakie było to jedzenie?- What did you eat today? What was the food like?

Straszne- Horrible

Obrzydliwe- Disgusting

If you would like Skype lessons from kamila please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

View Details

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on Youtube as Audio only https://www.youtube.com/channel/UCk5CEEWZ2KgUTYJOTXNL8lQ

New Awakening Podcast just released http://awakeningpodcast.org/

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Dezaprobata- Disapproval

Sytuacja, która Ci się nie podoba- A situation that you do not like

Jestem wstrząśnięty- I'm shocked (shaken)

Jestem oburzony- I am disgusted

Burza- Storm

Jestem zbulwersowany- I am shocked

Czym jesteś zbulwersowany?- What are you shocked with?

Jestem zbulwersowany bo na świecie jest dużo korupcji- I am shocked because there is a lot of corruption in the world

Rozwiązanie- Solution

Czym jesteś wstrząśnięty?- What are you shocked by?

Samochód jechał bardzo szybko- The car was going very fast

Kierowca była pijany- The driver was drunk

Dlaczego jesteś oburzony?- Why are you disgusted?

Cały czas muszę nosić maseczkę- I have to wear a mask all the time

Protestować przeciwko- To protest against

Przeciwko czemu protestujesz?- What do you protest against?

Protestuję przeciwko pedofilii- I protest against pedophilia

Protestuję przeciwko wojnie- I protest against the war

Protestuję przeciwko aborcji- I protest against abortion

If you would like Skype lessons from kamila please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

View Details

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on Youtube as Audio only https://www.youtube.com/channel/UCk5CEEWZ2KgUTYJOTXNL8lQ

New Awakening Podcast just released http://awakeningpodcast.org/

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Polskie idiomy- Polish idioms

Oko za oko- An eye for an eye

Jeśli ja robię coś złego, Ty będziesz robił to samo- If I am doing something wrong, you will do it yourself

Twoja filozofia- Your philosophy

Mieć oczy, uszy szeroko otwarte- To have eyes, ears wide open

Uwaga- Attention

Robić coś na oko- To do something about

Dodaję cukier na oko- I add sugar for the eye

Nie mam dokładnej proporcji- I do not have an exact proportion

Dawać sól na oko- To give salt for the eye

Nie wiesz ile- You don't know how much

Na oczach- On eyes

Na moich oczach on ukradł jej torebkę- In front of my eyes, he stole her bag

Cztery oczy- Face to face

Rozmawiać w cztery oczy- To talk face to face

Są tylko dwie osoby- There are only two persons

Pod okiem- To keep an eye on someone

Mam pracownika pod okiem- I keep an eye on my employee

Kogo masz pod okiem?- Who do you keep your eye on?

Strach ma wielkie oczy- Fear has big eyes

Panikujesz, a problem jest mały- You panic and the problem is small

If you would like Skype lessons from kamila please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

View Details

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on Youtube as Audio only https://www.youtube.com/channel/UCk5CEEWZ2KgUTYJOTXNL8lQ

New Awakening Podcast just released http://awakeningpodcast.org/

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Powiem Ci coś bardzo ważnego- I'll tell you something very important

Najważniejsze- The most important

Mówienie i zadawanie pytań- Talking and asking questions

Co to jest?- What is this?

To jest długopis- This is a pen

Jaki jest ten długopis?- What is this pen like?

Ten długopis jest jasno niebieski- This pen is light blue

Czyj jest ten długopis?- Whose is this pen?

To jest Twój długopis- This is your pen

Ty chcesz sprzedać ten długopis?- Do you want to sell this pen?

Czy masz długopis?- Do you have a pen?

Czy ten długopis jest nowy?- Is this pen new?

Jest trochę stary- He's a little old

Gdzie kupiłeś ten długopis?- Where did you buy this pen?

Ty lubisz ten długopis?- Do you like this pen?

Podoba mi się ten długopis- I like this pen

Czym piszesz?- What do you write with?

Piszę długopisem- I write with a pen

Ile kosztuje długopis w Polsce?- How much does a pen cost in Poland?

Może kosztować nawet 1000 złotych- It can cost up to PLN 1000 PLN

Co masz w ręku?- What's in your hand?

Jaki jest ten kubek?- What's the mug like?

Kubek z kwiatami- Mug with flowers

Skąd masz ten kubek?- Where did you get this mug from?

Ten kubek mam od syna- I have this mug from my son

Czy lubisz ten kubek?- Do you like this mug?

Pytać- To ask

Pytania to jest klucz żeby dobrze mówić po polsku- Questions are the key to speaking Polish well

If you would like Skype lessons from kamila please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

View Details

All Learn Polish Social Media at https://linktr.ee/learnpolish

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on Youtube as Audio only https://www.youtube.com/channel/UCk5CEEWZ2KgUTYJOTXNL8lQ

New Awakening Podcast just released http://awakeningpodcast.org/

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Jak podtrzymać rozmowę?- How to keep a conversation going?

Jak się masz?- How are you?

Co nowego?- What’s new?

Jak tam?- How are you?

Co tam?- What’s up?

Dobrze, wszystko w porządku, a u Ciebie?- Good, everything is fine, and you?

Jak minął weekend?- How was your weekend?

Mój weekend był dobry- My weekend was good

Byłem u fryzjera z moim synem- I was at the hairdresser with my son

Ładna fryzura- Nice hairstyle

Co jedliście w restauracji?- What did you eat in the restaurant?

Nuggetsy z kurczaka i frytki- Chicken nuggets and fries

Naturalna lemoniada- Natural lemonade

Nowy tydzień to nowe możliwości- The new week brings new opportunities

Jakie masz plany na ten tydzień?- What are your plans for this week?

Wywiad- Interview

W środę rano mam spotkanie z kolegami- On Wednesday morning I have a meeting with my colleagues

Lekcje polskiego- Polish lessons

Trochę medytacji, trochę relaksu- A bit of meditation, a bit of relax

Ty miałeś urodziny w weekend- You had a birthday on the weekend

Byłem z kolegami w centrum- I was with my friends in the center

Kilka piw- A few beers

Było miło- It was nice

Wracałeś do domu taksówką?- Did you go home by taxi?

Cieszę się, że masz plan na cały tydzień- I'm glad you have a plan for the whole week

Jakie Wy macie plany na ten tydzień?- What are your plans for this week?

Jak Wam minął weekend?- How was your weekend?

If you would like Skype lessons from kamila please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

View Details

All Learn Polish Social Media at https://linktr.ee/learnpolish

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on Youtube as Audio only https://www.youtube.com/channel/UCk5CEEWZ2KgUTYJOTXNL8lQ

New Awakening Podcast just released http://awakeningpodcast.org/

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Taksówka- Taxi

Rozmawiamy o taksówkach- We are talking about taxis

Czy jeździsz taksówką?- Do you take a taxi?

Kiedy spotykam się z kolegami i pije piwo to nie mogę wracać samochodem- When I meet my friends and drink beer, I can't go back by car

Zamawiać (zamówić) taksówkę- To order a taxi

Chciałbym zamówić taksówkę- I would like to order a taxi

Chciałabym zamówić taksówkę- I would like to order a taxi

Dzień dobry, w czym mogę pomóc?- Good morning, how can I help you?

Chciałbym zamówić taksówkę- I would like to order a taxi

Na jaki adres?- To what address?

Jaki numer?- What number?

Na jakie nazwisko?- What surname?

Taksówka będzie za pół godziny- The taxi will be here in half an hour

Kierowca taksówki- Taxi driver

Dokąd jedziemy?- Where are we going?

Jedziemy na ulicę Piotrkowską- We're going to Piotrkowska Street

Jesteśmy na miejscu- We are there

Czy mogę płacić kartą?- Can I pay by card?

Niestety, tylko gotówką- Unfortunately, only in cash

Reszta dla Pana- Keep the change (the change is for you)

Czy lubicie jeździć taksówką?- Do you like to take a taxi?

Czy często jeździcie taksówką?- Do you often take a taxi?

If you would like Skype lessons from kamila please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

View Details

All Learn Polish Social Media at https://linktr.ee/learnpolish

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on Youtube as Audio only https://www.youtube.com/channel/UCk5CEEWZ2KgUTYJOTXNL8lQ

New Awakening Podcast just released http://awakeningpodcast.org/

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Miesiące- Months

Znasz miesiące po polsku?- Do you know months in Polish?

Styczeń- January

Luty- February

Marzec- March

Kwiecień- April

Maj- May

Czerwiec- June

Lipiec- July

Sierpień- August

Wrzesień- September

Październik- October

Listopad- November

Grudzień- December

W styczniu- In January

W lutym- In February

W marcu- In March

W kwietniu- In April

W maju- In May

W czerwcu- In June

W lipcu- In July

W sierpniu- In August

We wrześniu- In September

W październiku- In October

W listopadzie- In November

W grudniu- In December

Ile miesięcy ma rok?- How many months has a year?

Rok ma dwanaście miesięcy- There are twelve months a year

Jaki teraz jest miesiąc?- What month is it now?

Kiedy jest Nowy Rok?- When is the new year?

Nowy Rok jest w styczniu- The new year is in January

Kiedy są Walentynki?- When is Valentine's Day?

Walentynki są w lutym- Valentine's Day is in February

Kiedy jest Dzień Kobiet?- When is Women's Day?

Dzień Kobiet jest w marcu- Women's Day is in March

Kiedy jest Prima Aprilis?- When is April Fool's Day?

Kiedy jest Dzień Matki?- When is Mother's Day?

Kiedy jest Dzień Dziecka?- When is Children's Day?

Kiedy ja mam urodziny?- When is my birthday?

Kiedy dzieci mają wakacje?- When do children have holiday?

Dzieci mają wakacje w lipcu i w sierpniu- Children have holiday in July and August

Kiedy dzieci idą do szkoły?- When do the children go to school?

Kiedy masz urodziny?- When is your birthday?

Kiedy jest Święto zmarłych?- When is All Saint’s Day?

Święto zmarłych jest w listopadzie- All Saint’s Day is in November

Kiedy jest Boże Narodzenie?- When is Christmas?

Kiedy Twój syn urodził się?- When was your son born?

Kiedy Twoja mama urodziła się?- When was your mom born?

Napiszcie kiedy urodziliście się- Write when you were born

If you would like Skype lessons from kamila please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

View Details

All Learn Polish Social Media at https://linktr.ee/learnpolish

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on Youtube as Audio only https://www.youtube.com/channel/UCk5CEEWZ2KgUTYJOTXNL8lQ

New Awakening Podcast just released http://awakeningpodcast.org/

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Bajka- Fairytale

Znasz jakąś bajkę po polsku?- Do you know any fairytale in Polish?

Czerwony Kapturek- Red Riding Hood

Mama poprosiła córeczkę żeby poszła do chorej babci- Mom asked her daughter to go to her sick grandmother

Zanieść jedzenie i lekarstwa chorej babci- To take food and medicine to sick grandmother

Idź prosto przez las, z nikim obcym nie rozmawiaj- Go straight through the forest, don't talk to any stranger

Zrywać kwiatki- To pick flowers

Słuchać śpiewu ptaków- To hear the birds sing

Nagle spotkała wilka- Suddenly she met a wolf

Dokąd idziesz dziewczynko?- Where are you going little girl?

Babcia mieszka na końcu lasu- Grandma lives at the end of the forest

Wilk szybko pobiegł do domku babci- The wolf quickly ran to the grandmother's house

Wilk zapukał- The wolf knocked

Kto tam?- Who's there?

Wilk wszedł do środka- The wolf went inside

Wilk zjadł babcię- The wolf ate grandma

Potem przyszła dziewczynka- Than the girl came

Babcia wygląda dziwnie- Grandma looks weird

Babciu, dlaczego masz takie wielkie oczy?- Grandma, why do you have such big eyes?

Żebym Cię mogła lepiej widzieć- So that I could see you better

Babciu, dlaczego masz takie wielkie uszy?- Grandma, why do you have such big ears?

Żebym Cię mogła lepiej słyszeć- So that I can hear you better

Babciu, dlaczego masz takie wielkie zęby?- Grandma, why do you have such big teeth?

Żebym Cię mogła zjeść- So that I can eat you

Wilk poszedł spać- The wolf went to sleep

Głośno chrapać- To snore loudly

Pan leśniczy usłyszał chrapanie wilka- The ranger heard the wolf's snoring

Domyślił się, że wilk zjadł babcię- He guessed the wolf ate Grandma

Myśliwy rozpruł brzuch wilkowi- The hunter tore open the wolf's stomach

Włożyć kamienie do brzucha- To put the stones in the stomach

Pić – To drink

A jaką Wy znacie wersję?- What version do you know?

If you would like Skype lessons from kamila please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

View Details

All Learn Polish Social Media at https://linktr.ee/learnpolish

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on Youtube as Audio only https://www.youtube.com/channel/UCk5CEEWZ2KgUTYJOTXNL8lQ

New Awakening Podcast just released http://awakeningpodcast.org/

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Transport- Transport

Rodzaje transportu- Types of transport

Transport lądowy- Land transport

Transport powietrzny- Air transport

Transport wodny- Water transport

Możemy jechać samochodem- We can go by car

Możemy jechać motocyklem- We can go by motorcycle

Możemy jechać rowerem- We can go by bicycle

Możemy jechać pociągiem- We can go by train

Możemy jechać tramwajem- We can go by tram

Możemy jechać taksówką- We can go by taxi

Możemy jechać autobusem- We can go by bus

Możemy jechać metrem- We can go by subway

Możemy jechać dorożką- We can ride a carriage

Jaki jest Twój ulubiony transport lądowy?- What is your favorite land transport?

Lubię jeździć rowerem- I like cycling

Transport powietrzny- Air transport

Możemy podróżować balonem- We can travel with a balloon

Możemy podróżować helikopterem- We can travel by helicopter

Możemy podróżować samolotem- We can travel by plane

Możemy podróżować rakietą- We can travel by rocket

Jaki jest Twój ulubiony transport powietrzny? - What is your favorite air transport?

Kajak- Kayak

Możemy pływać kajakiem- We can kayak

Możemy pływać statkiem- We can sail a ship

Możemy pływać łódką- We can sail a boat

Możemy pływać katamaranem- We can go catamaran

Najbardziej lubisz rower, samolot i statek- You like bicycle, plane and ship the most

Jestem leniwa- I am lazy

Nie lubię dużych statków- I don't like big ships

Jacht- Yacht

Jaki środek transportu lubicie? Napiszcie komentarze- What kind of transport do you like? Write your comments.

If you would like Skype lessons from kamila please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

View Details

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on Youtube as Audio only https://www.youtube.com/channel/UCk5CEEWZ2KgUTYJOTXNL8lQ

New Awakening Podcast just released http://awakeningpodcast.org/

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Co to jest?- What is this?

Mogę zobaczyć?- Can I take a look?

Lista kursów- Course list

Kurs fotografii- Photography course

Lubisz robić zdjęcia?- Do you like taking photos?

Kurs obsługi komputera- Course of computer usage

Projektowanie stron internetowych- Web design

Kurs języka polskiego- Polish language course

Kurs nurkowania- Diving course

Dużo kursów- Lots of courses

Skoki spadochronowe- Parachuting

Kurs prawa jazdy- Driving course

Motocykl- Motorbike

Samochód- Car

Zdałem egzamin za pierwszym razem- I passed the exam the first time

Zdać egzamin- To pass the exam

Słownik- Dictionary

Kurs pływania- Swimming course

Dawno temu- Long time ago

Zrobiłeś dużo kursów- You did a lot of courses

Lubię uczyć się czegoś nowego- I like to learn something new

Na kursach możesz poznać fajnych ludzi- During the courses you can meet cool people

Kurs medytacji- Meditation course

Kurs jogi- Yoga course

Możemy mieć nowe umiejętności- We can have new skills

Super pomysł- Great idea

Powodzenia- Good luck

Czy Wy lubicie kursy? Na jakie kursy chodziliście?- Do you like courses? What courses did you take?

Czy planujecie iść na kurs? - Are you planning to go to the course?

If you would like Skype lessons from kamila please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

View Details

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on Youtube as Audio only https://www.youtube.com/channel/UCk5CEEWZ2KgUTYJOTXNL8lQ

New Awakening Podcast just released http://awakeningpodcast.org/

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Lato się kończy- Summer is ending

Nachodzi jesień- Autumn is coming

Depresja – Depression

Jest brzydka pogoda – The weather is bad

Pada deszcz- It's raining

Narzekać- To complain

Czy Ty narzekasz?- Do you complain?

Nigdy nie narzekam- I never complain

Jest zimno- It is cold

Dzień jest bardzo krótki- The day is very short

Kolorowe liście- Colorful leaves

Dni są szare- The days are gray

Mieć tendencje do narzekania- To have a tend to complain

Dieta się zmienia- The diet is changes

Zimne jedzenie- Cold food

Gorąca zupa- Hot soup

Gorąca czekolada- Hot chocolate

Kiedy jest jesień zmienia się dieta- When it is autumn, the diet changes

Zmieniamy ubrania- We change clothes

Robić porządek w szafie- To tidy up the closet

Wszystkie letnie ubrania będę wkładać do pudełka- I will put all summer clothes in the box

Ubrania jesienno zimowe- Fall and winter clothes

Zmieniają się kolory, które lubimy- The colors we like change

Planujesz sprzątać dom?- Are you planning to clean the house?

Czuję, że nadchodzi jesień- I feel autumn is coming-

Lubisz jesień?- Do you like autumn

Więcej czasu jestem w domu- More time I'm home

Wieczór jest dłuższy- The evening is longer

Dynia- Pumpkin

Pieczona dynia- Baked pumpkin

Czy lubicie jesień? Lubicie zmieniać coś w życiu jak nadchodzi jesień?- Do you like autumn? Do you like to change something in your life when autumn comes?

If you would like Skype lessons from kamila please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

View Details

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

Now also on Youtube as Audio only https://www.youtube.com/channel/UCk5CEEWZ2KgUTYJOTXNL8lQ

New Awakening Podcast just released http://awakeningpodcast.org/

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Ładna koszula – Nice shirt

Ładna sukienka – Nice dress

Lubię kolczyki – I like earrings

Co jest dla Ciebie najważniejsze w życiu? – What is the most important in your life?

Ważne, ważniejsze, najważniejsze – Important, more important, the most important

Najważniejsza dla mnie jest moja rodzina – The most important thing for me is my family

Dzieci – Children

Rodzice – Parents

Każdego dnia muszę być szczęśliwym – I must be happy each day

Przyjaciele – Friends

Masz dużo przyjaciół? – Do you have a lot of friends?

Przyjaciele na całym świecie – Friends around the whole world

Zdrowie – Health

Trudne pytanie – Difficult question

Kiedy jesteś chory nic nie możesz zrobić – When you are sick there is nothing you can do

Praca jest dla mnie ważna – Work is important to me

Miłość jest bardzo ważna – Love is very important

Kariera, sukces – Career, success

Jaką masz misję w życiu? – What is your mission in life?

Moja misja to cztery podcasty tygodniowo – My mission is four podcasts weekly

Różne rozwiązania – Different solutions

Pomaganie innym – Helping others

Najważniejsze w życiu dla mnie jest zrozumienie kim naprawdę jestem – The most important thing in life for me is to understand who I really am

Samorealizacja – Self Realization

Potrzeby – Needs

Medytacja jest potrzebna – Meditation is needed

Co jest dla Was najważniejsze w życiu? Napiszcie w komentarzach - What is the most important thing in your life? Write in the comments

If you would like Skype lessons from kamila please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

View Details

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

New Awakening Podcast just released http://awakeningpodcast.org/

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Przeprowadzka – Moving

Mieszkasz w domu czy w bloku? Do you live in house or in a block of flats?

Mieszkam w domu- I live in house

Lubisz swój dom? – Do you like your house?

Mogę leżeć w ogrodzie i jeść śniadania na słońcu – I can lie in the garden and eat breakfast in the sun

Co jedliście na śniadanie? - What did you eat for breakfast?

Jajecznica – Scrambled eggs

Łosoś – Salmon

Przeprowadzać się – To move

Czy lubisz przeprowadzać się ? - Do you like moving?

Przenieść rzeczy ze starego domu to nowego domu – To move things from the old house to the new one

Fundacja – Foundation

Planujesz przeprowadzać się? – Are you planning to move?

Ile razy przeprowadzałeś się w Twoim życiu? - How many times have you moved in your life?

Z Irlandii do Polski - From Ireland to Poland

Kupiłem dom – I bought a house

Od rodziców do dziewczyny – From parents to girlfriend

Przeprowadzałem się dziewięć razy – I've moved nine times

Nie lubię sprzątać, pakować rzeczy – I don't like to clean, pack my things

Mam dużo książek – I have a lot of books

Kiedy ostatni raz przeprowadzałeś się? – When was the last time you moved?

W marcu tego roku – In March this year

Jak długo przeprowadzałeś się? - How long have you been moving?

Przeprowadzać się ze starego domu do nowego – Moving from an old house to a new one

Pakować rzeczy – Pack things

Firma transportowa – Transport company

A czy Wy lubicie przeprowadzać się? Napiszcie komentarze - Do you like to move? Write your comments.

If you would like Skype lessons from kamila please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

View Details

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

New Awakening Podcast just released http://awakeningpodcast.org/

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Zdrowie - Health

Jakie sytuacje służą zdrowiu? - What situations are good for health?

Jakie sytuacje szkodzą zdrowiu? - What situations are harmful to health?

Co jest dobre dla zdrowia? - What's good for health?

Regularne ćwiczenie - Regular exercise

Uprawianie gimnastyki w domu - Practicing gymnastics at home

Skakanie na trampolinie - Jumping on trampoline

Bieganie - Running

Pływanie - Swimming

Joga - Yoga

Medytacja - Meditation

Zdrowe jedzenie – Healthy food

Naturalne (BIO) sałatki, owoce, warzywa - Natural (BIO) salads, fruits, vegetables

Spacery, podróżowanie - Walking, traveling

Mieć kontakt z naturą – To have a contact with nature

Dobrze spać – To sleep well

Co jest niedobre dla zdrowia? - What's bad for health?

Palenie papierosów - Smoking

Dużo alkoholu – A lot of alcohol

Kieliszek (lampka) wina – A glass of wine

Alkohol szkodzi zdrowiu - Alcohol is harmful to health

Narkotyki - Drugs

Uzależniony od czegoś - Addicted to something

Ludzie są uzależnieni od Internetu, od pracy - People are addicted to the Internet, to work

Jedna kawa dziennie - One coffee a day

Hazard - Gambling

Czy uprawiasz hazard? - Are you gambling?

Przegrać – To lose

Solarium nie jest dobre dla skóry - Tanning beds (solarium) are not good for the skin

Porady - Tips

Co musisz zrobić żeby być zdrowym? - What do you have to do to be healthy?

Czego nie wolno robić? - What is not allowed to do?

Nie wolno palić papierosów, brać narkotyków - You musn’t smoke cigarettes, take drugs

Jak myślicie? Co jeszcze szkodzi zdrowiu? – How do you think? What else is bad for your health?

Napiszcie nam Wasze porady - Write us your tips

If you would like Skype lessons from kamila please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

View Details

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

New Awakening Podcast just released http://awakeningpodcast.org/

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Jestem bardzo zmęczona – I am very tired

Ziewać – To yawn

Ziewałam – I was yawning

Chce mi się spać – I am sleepy, I want to sleep

Nie jestem zmęczony – I am not tired

Mam dużo energii – I have a lot of energy

Ile godzin spałeś? – How many hours did you sleep?

Ja spałam tylko trzy godziny - I slept only three hours

Dużo pracowałam, czytałam, rozmawiałem - I worked a lot, read and talked

Czuje się fatalnie - I feel terrible

Wyspać się – To get enough sleep, to sleep well

Nie wyspałam się - I have not slept well

Dzisiaj muszę iść wcześniej spać - I have to go sleep early today

Ty chodzisz spać bardzo późno - You go sleep very late

Budzisz się o szóstej rano - You wake up at six in the morning

Skakać – To jump

Ja skaczę na trampolinie - I jump on the trampoline

Zasnąć – To fall asleep

Co robisz kiedy nie możesz zasnąć - What do you do when you can't fall asleep

Jakie są metody kiedy ludzie nie mogą zasnąć - What are the methods when people can not sleep

Mama daje dziecku ciepłe mleko - Mom gives the baby warm milk

Możemy medytować - We can meditate

Ludzie mogą liczyć barany - People can count sheeps

Dlaczego ludzie nie mogą spać? - Why people can not sleep?

Ludzie mają dużo na głowie - People have a lot on their mind

Dużo stresu, dużo problemów – A lot of stress, a lot of problems

Redukować stres – To reduce stress

Pisać na papierze problemy, które są w głowie – To write down on paper the problems which are in head

To działa – It works

Mam dużo problemów – I have a lot of problems

A czy Wy macie problemy z zasypianiem? - Do you have problems to fall asleep?

Co robicie kiedy nie możecie zasnąć? - What do you do when you can't fall asleep?

Dobranoc – Good night

If you would like Skype lessons from kamila please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

View Details

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

New Awakening Podcast just released http://awakeningpodcast.org/

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

O czym chcesz dzisiaj porozmawiać ze mną? What do you want to talk to me about today?

Wspomnienia z dzieciństwa Memories childhood

Czytać, czytałem To read, I read

Jechać, jechałem To go, I was going

Spać, spałem To sleep, I slept

Czas przeszły The past tense

Co robiłeś kiedy byłeś małym chłopcem? What were you doing when you were a little boy?

Kiedy byłem małym chłopcem, grałem w piłkę nożną When I was a little boy, I played football

Piłka koszykowa (koszykówka) Basketball

Co jeszcze robiłeś? What else did you do?

Uprawiałem sport, karate, jogę I did sports, karate and yoga

Ja biegałem I was running

Co lubiłeś jeść? What did you like to eat?

Cukierki Sweets

To było dawno temu It was a long time ago

Czy jeździłeś na rowerze? Have you ridden a bike?

Miałeś kolegów? Did you have friends?

Co robiliście z kolegami? What were you doing with your friends?

Codziennie coś innego Something different every day

Czy lubiłeś chodzić do szkoły? Did you like going to school?

Jakie miałeś hobby kiedy byłeś dzieckiem? What were your hobbies when you were a kid?

Zbierałem znaczki I collected stamps

Miałeś dużo hobby You had a lot of hobbies

Co robiłaś kiedy byłaś małą dziewczynką? What did you do when you were a little girl?

Bardzo lubiłam uczyć moje lalki I really liked teaching my dolls

Ja rozmawiam z lalkami I am talking to dolls

Zawsze chciałam być nauczycielką I've always wanted to be a teacher

Uczyć lalki To teach dolls

Lubiłam spacerować, pływać I liked walking and swimming

Jakie macie wspomnienia z dzieciństwa? Proszę napiszcie co robiłaś kiedy byłaś małą dziewczynka, co robiłeś kiedy byłeś małym chłopcem?

What are your childhood memories? Please write down what did you do when you were a little girl, when you were a little boy?

If you would like Skype lessons from kamila please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

View Details

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

New Awakening Podcast just released http://awakeningpodcast.org/

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Planuję coś kupić - I am planning to buy something

Chciałabym kupić nową biżuterię - I would like to buy new jewelry

Lubisz biżuterię? - Do you like jewelry?

Ja noszę biżuterię - I wear jewelry

Jaką masz biżuterię? - What jewelry do you have?

Pierścionki - Rings

Pierścionki mogą być złote lub srebrne - Rings can be gold or silver

Czy masz bransoletkę? - Do you have a bracelet?

Czy masz kolczyki? - Do you have earrings?

Miałem kolczyk w uchu - I had an earring in my ear

Naszyjnik - Necklace

Lubisz kupować biżuterię na prezent? - Do you like buying jewelry as a gift?

Jubiler (idziemy do jubilera) - Jeweler (we go to the jeweler)

Dzień dobry, w czym mogę pomóc? - Good morning, how can I help you?

Chcielibyśmy kupić biżuterię dla mojej koleżanki - We would like to buy jewelry for my friend

Białe złoto - White gold

Co Państwo chcą? Kolczyki, naszyjnik, pierścionek, bransoletkę?

What do you want? Earrings, necklace, ring, bracelet?

Cały zestaw biżuterii - The whole set of jewelry

Mam piękny zestaw za 1000 PLN - I have a beautiful set for 1000 PLN

To jest nowa kolekcja - This is a new collection

Niebieski diament – Blue diamond

Jaki rozmiar ma Pana koleżanka? – What is your friend’s size?

Czy może zwrócić i wymienić? - Can she return it and change?

Ona musi mieć paragon - She must have a receipt

Czy będzie rabat jak kupię wszystko? - Will there be a discount if I buy everything?

20% rabatu - 20% discount

Płaci Pan kartą czy gotówką? - Do you pay by card or cash?

Torba jest za darmo - The bag is for free

A Wy, lubicie biżuterię? Wolicie złotą czy białą biżuterię? Jaką biżuterię nosicie? – Do you like jewelry? Do you prefer gold or white jewelry? What jewelry do you wear?

If you would like Skype lessons from kamila please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

View Details

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

New Awakening Podcast just released http://awakeningpodcast.org/

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Chciałbym kupić nowe buty - I would like to buy new shoes

Ty nie masz butów - You do not have shoes

Czy lubisz chodzić bez butów (na boso)? - Do you like to walk without shoes (barefoot)?

Trawa - Grass

Plaża - Beach

Masz nowe buty czy stare buty? - Do you have new shoes or old shoes?

Idziemy do sklepu kupić nowe buty? - Are we going to the shop to buy new shoes?

Możemy iść - We can go

Sklep obuwniczy - Shoe shop

Obuwie = buty - Shoes

Buty zimowe - Winter shoes

Buty wiosenne - Spring shoes

Buty letnie - Summer shoes

Buty jesienne - Autumn shoes

Jakie chcesz kupić buty? - What kind of shoes do you want to buy?

Czy masz buty letnie? - Do You have summer shoes?

Sandały - Sandals

Jakie koloru masz sandały? - What color are your sandals?

Czy masz klapki? - Do you have flip – flops shoes?

Czy masz japonki? - Do you have flip – flops shoes?

Czy masz buty sportowe? - Do you have sport shoes?

Sprzedawczyni - Saleswoman

Dzień dobry, w czym mogę pomóc? - Good morning, how can I help you?

Chciałbym kupić jesienne buty - I would like to buy autumn shoes

Męskie buty jesienne - Men's autumn shoes

Jakiego koloru? Czarne - What color? Black

Eleganckie czy sportowe buty? - Elegant or sports shoes?

Półbuty - Shoes

Nie mamy czarnego koloru - We do not have black ones

Może być beżowy - It can be beige

Jaki rozmiar? Rozmiar 43 - What size? Size 43

Czy mogę przymierzyć? - Can I try it on?

Czy pasują? - Do they fit?

Są za ciasne - They are too tight

Inny styl butów - Different style of shoes

Te niebieskie buty są ładne i modne w tym sezonie - These blue shoes are pretty and trendy this season

Ile kosztują? - How much are they?

One są bardzo drogie - There are very expensive

Buty z nowej kolekcji - The shoes from the new collection

Buty kosztują 350 złotych - The shoes cost 350 PLN

Buty są bardzo wygodne - The shoes are very comfortable

Czy płaci Pan kartą czy gotówką? - Do you pay by card or in cash?

Proszę wpisać PIN - Please enter your PIN

Transakcja jest zrealizowana - The transaction is complete

A wy lubicie kupować buty? Jakie macie buty? - Do you like buying shoes? What kind of shoes do you have?

Buty na obcasie - High heels

If you would like Skype lessons from kamila please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

View Details

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

New Awakening Podcast just released http://awakeningpodcast.org/

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Zakupy w sklepie odzieżowym - Shopping in a clothing store

Sklep odzieżowy - Clothing store

Ubrania = odzież - Clothes

Idziemy do sklepu odzieżowego kupić nowe ubrania - We go to a clothing store to buy new clothes

Potrzebuję nowych ubrań - We need new clothes

Co mówisz w sklepie? - What are you saying in the store?

W czym mogę pomóc? - How can I help you?

Chciałbym kupić nowe spodnie - I would like to buy new trousers

Jaki ma Pan rozmiar? - What is your size?

Jaki ma Pan wzrost? - What is your height? (How tall are you)

180 centymetrów wzrostu, 34 w biodrach - 180 centimeters height, 34 in the hips

Jaki kolor Pani interesuje? - What color are you interested in?

Różowe, zielone spodnie - Pink, green trousers

Czy mogę przymierzyć? - Can I try on?

Tak, przymierzalnia jest tam - Yes, changing room is over there

Czy mogę wziąć dwa rozmiary? - Can I take two sizes?

Mniejszy (większy) rozmiar - Smaller (bigger) size

Ty chcesz mniejszy rozmiar - You want a smaller size

Numer (rozmiar) 33, 34 - Number (size) 33, 34

Przymierzać ubrania - To try clothes on

Rozmiar 34 jest lepszy dla mnie - Size 34 is better for me

Kupuje Pan? Zapakować? - Are you buying? Do You want me to pack it up?

Czy mogę płacić kartą? - Can I pay by card?

Niestety, tylko gotówką - Unfortunately, cash only

Terminal nie działa - Terminal is not working

Czy ma Pan gotówkę? - Do you have cash?

Zmieniłem zdanie - I have changed my mind

Dlaczego? - Why?

Te spodnie są za drogie - These trousers are too expensive

Szkoda - It’s a pitty

Spodnie były bardzo drogie - Trousers were very expensive

Kupię spodnie przez - Internet I will buy trousers online

Jakoś jest ważna, nie marka - Quality is important, not the brand

If you would like Skype lessons from kamila please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

View Details

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

New Awakening Podcast just released http://awakeningpodcast.org/

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Dawno Cię nie widziałam - I have not seen you for a long time

Jak było? - How was it?

Pogoda była piękna, świeciło słońce - The weather was beautiful, the sun was shining

Polskie morze jest fantastyczne - The Polish sea is fantastic

Byłeś nad polskim morzem? - Have you been at the Polish seaside?

Lubisz Sopot? - Do you like Sopot?

Jakie znasz Polskie miasta nad morzem? - What cities at the Polish seaside do you know?

Znam Gdańsk, Gdynię i Sopot - I know Gdańsk, Gdynia and Sopot

Warszawa nie jest nad morzem - Warsaw is not at the seaside

Znasz Hel, Krynicę Morską - You know Hel, Krynica Morska

Ile razy byłeś nad polskim morzem? - How many times have you been at the Polish seaside?

Cztery razy - Four times

W tym roku planujesz jechać nad polskie morze? -

Are you planning to go to the Polish seaside this year?

Nie planujesz urlopu? - Are you not planning holiday (leave?)?

Nie jesteś pracoholikiem? - You're not a workaholic?

Gdzie ludzie jeżdżą na wakacje? - Where do people go on holiday?

Ludzie jeżdżą do Grecji, Hiszpanii, Portugalii, Włoch - People go to Greece, Spain, Portugal, Italy

Co myślisz o Polsce? Czy to jest dobry kraj na wakacje? -

What do you think about Poland? Is it a good country for holiday?

Co możemy zobaczyć w Polsce? - What can we see in Poland?

Na północy możemy zobaczyć Morze Bałtyckie. - In the north we can see the Baltic Sea.

Co jest na południu Polski? Góry. - What's in the south of Poland? Mountains.

Jak się nazywają polskie popularne góry? Tatry. -

What are the popular Polish mountains called? Tatra Mountains.

Pierwszy raz słyszysz? - Do you hear it first time?

Musisz jechać - You must go

Polskie góry są bardzo piękne - Polish mountains are very beautiful?

Co możemy robić w górach? - What can we do in the mountains?

Spacerować, oglądać naturę. - To walk, to watch nature

Natura, przyroda. - Nature

Zakopane to jest popularne miasto. - Zakopane is a popular city.

Bardzo dobry regionalny ser górski – Oscypek - Very good regional mountain cheese - Oscypek

Musisz jechać w góry, naprawdę warto. - You must go to the mountains, it's really worth it.

Co możemy robić nad morzem? - What can we do at the seaside?

Możemy pływać, jeść lody, opalać się - We can swim, eat ice cream, sunbathe

Teraz masz ochotę jechać na wakacje? - Now you feel like going on holiday?

W góry czy nad morze? - To the mountains or to the sea?

A Wy, dokąd jedziecie na wakacje, a może już byliście? W Polsce lub w innym kraju? -

And you, where are you going on holiday, or maybe you've already been? In Poland or in another country?

If you would like Skype lessons from kamila please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

View Details

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

New Awakening Podcast just released http://awakeningpodcast.org/

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Jadę na wakacje - I am going on holiday

Jadę na wakacje nad polskie morze - I'm going on holiday to the Polish seaside

Na jak długo? - For how long?

Na tydzień - For a week

Co będziesz robić na plaży - What are you going to do on the beach?

Będę spacerować po plaży - I'll be walking on the beach

Bez butów - Without shoes

Lubię ciepły piasek - I like warm sand

Będę pływać w morzu - I will swim in the sea

Będę się opalać - I will sunbathe

Mam nadzieję, że będzie ładna pogoda - I hope that the weather will be nice

Lubię kiedy jeść gorąco - I like when is hot

Jakie lody lubisz? - What kind of ice cream do you like?

Nie lubię czekoladowych - I don't like chocolate ice cream

Lubię lody owocowe - I like fruit ice cream

Będę dużo odpoczywać - I will rest a lot

Planuję oglądać wschody i zachody słońca - I plan to watch the sunrises and sunsets

Ja oglądam słońce - I am watching the sun

Nie używam często telefonu - I don't use the phone often

Nie będę używać telefonu - I will not use the phone

Planuję spędzać czas w naturze - I plan to spend time in nature

Grillowane warzywa - Grilled vegetables

Grillowane ziemniaki - Grilled potatoes

Następnym razem - Next time

Będę gotować, nie będę chodzić do restauracji - I will cook, I will not go to restaurants

Będę wynajmować dom - I will be renting a house

Nie będziemy się spotykać - We are not going to meet

Będziesz tęsknić? - Will you miss me?

Ja będę powtarzał wszystkie podcasty - I will repeat all podcasts

Napiszcie w komentarzach, gdzie wy jeździcie na wakacje, nad morze czy w góry?

  • Write in your comments where do you go on holiday, to the seaside or to the mountains?

If you would like Skype lessons from kamila please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

Please Share with your friends / Subscribe and give a 5* Review - Thank You (Dziekuje Bardzo :) )

View Details

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

New Awakening Podcast just released http://awakeningpodcast.org/

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Dobra, miła, łatwa lekcja - A good, nice, easy lesson

Ulubione rzeczy - Favorite things

Jakie jest Twoje ulubione imię? - What's your favorite name?

Męskie imię, żeńskie imię - Male name, female name

Jakie jest Twoje ulubione zwierzę? - What is your favorite animal?

Kot - A cat

Jakie jest Twoje ulubione miasto w Polsce? - What is your favorite city in Poland?

Łódź - Lodz

Jakie jest twój ulubiony kolor? - What's your favorite color?

Czerwony i czarny - Red and black

Jakie jest Twoje ulubione Państwo? - What is your favorite country?

Byłem w 40 krajach. - I've been to 40 countries.

Nasz kraj, Polska - Our country, Poland

Jakie jest Twój ulubiony napój latem? - What's your favorite summer drink?

Zależy, kiedy robimy grill może być piwo, czasami dobre wino - It depends, when we make a barbecue it can be beer, sometimes good wine

Jaka jest Twoja ulubiona książka? - What is your favorite book?

Jaki jest Twój ulubiony film? - What's your favorite movie?

Jaka jest Twoja ulubiona pizza? - What's your favorite pizza?

Bez mięsa, pizza wegetariańska, margherita - With no meat, vegetarian pizza, margherita

Jaki jest Twój ulubiony sport? - What is your favorite sport?

Squash - Squash

Jaki jest Twój ulubiony program telewizyjny? - What's your favorite TV program?

Nie wiem, nie mam ulubionego programu. I - don't know, I don't have a favorite one.

Jaki jest Twój ulubiony dzień tygodnia? - What is your favorite day of the week?

Dla mnie to nie jest ważne, czasami pozytywny może być poniedziałek. -

It doesn't matter to me, sometimes Monday can be positive.

Mój ulubiony dzień tygodnia to poniedziałek, nowy tydzień, nowe możliwości, nowa energia. -

My favorite day of the week is Monday, a new week, new possibilities, new energy.

Jaki jest Twój ulubiony piosenkarz? - What is your favorite singer?

Jaka jest Twoja ulubiona piosenkarka? - Who is your favorite singer?

Nie mam - I do not have

Kiedy byłeś studentem jaki był Twój ulubiony przedmiot? -

When you were a student what was your favorite subject?

Rysowanie - Drawing

Jakie jest Twój ulubiony owoc? - What's your favorite fruit?

Mango - Mango

Jakie jest Twoje ulubione warzywo? - What's your favorite vegetable?

Nie mam - I do not have

Jakie jest Twoje ulubione ubranie? - What is your favorite outfit?

Dobre buty, wygodne buty są najważniejsze -

Good shoes, comfortable shoes are the most important

Jakie są Twoje ulubione buty? - What are your favorite shoes?

Jaki mają kolor? - What color are they?

Czarny z żółtymi sznurówkami, wysokie, z zamkiem, w środku jest futro -

Black with yellow laces, tall, with a zipper, there is fur inside

Wiemy - We know

Jaka jest Twoja ulubiona zupa? - What's your favorite soup?

Rosół - Chicken soup

Zapraszamy do dyskusji o waszych ulubionych rzeczach. -

We invite you to the discussion about your favorite things.

If you would like Skype lessons from kamila please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

View Details

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

New Awakening Podcast just released http://awakeningpodcast.org/

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Ważny temat - Important topic

Rozmowa kwalifikacyjna - Interview

Szukać - To look for

Ja szukam pracy, Ty szukasz pracy - I am looking for a job, you are looking for a job

Czy szukasz pracy? - Are you looking for a job?

Grać role - To play a role

Ja jestem pracodawcą - I am an employer

Kandydat - Candidate

Różne pytania - Various questions

Dzień dobry, jak się Pan nazywa? - Hello, what's your name?

Nazywam się….. - My name is…

Jakie ma Pan wykształcenie? - What is your education?

Podstawowe - Primary education

Średnie - Secondary education

Wyższe - Higher education

Pan ukończył uniwersytet - You graduated from the university

Studia licencjackie czy magisterskie - BA or MA studies

Mam dwa dyplomy, licencjat i dyplom magistra - I have two diplomas, bachelor's degree and master's degree

Czy ma Pan prawo jazdy? - Do you have a driving license?

Jakie ma Pan doświadczenie zawodowe? - What is your professional experience?

Gdzie Pan pracował? - Where did you work?

Pracowałem w firmie na stanowisku menagera - I worked in the company as a manager

Jestem przedsiębiorcą - I am a trader

Jakie Pan zna języki? - What languages do you know?

Znam angielski, trochę język polski, trochę mówię po irlandzku - I know English, a little Polish, I can speak a little Irish

Jakie są Pana zainteresowania? - What are your interests?

Rozwój osobisty - Personal development

Lubię czytać książki - I like reading books

Możecie napisać czy mieliście rozmowę kwalifikacyjną po polsku, czy uczycie się polskiego żeby dostać pracę. - You can write whether you had an interview in Polish, or are you learning Polish to get a job.

If you would like Skype lessons from kamila please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

View Details

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

New Awakening Podcast just released http://awakeningpodcast.org/

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Szczęśliwy - Happy, Lucky

Osobowość - Personality

Mądry - Smart

Cechy charakteru - Features

Jakie masz cechy charakteru? - What features do you have?

Zalety - Advantages

Jakie masz zalety? - What are your advantages?

Jestem mądry, cały czas uczę się czegoś . - I'm smart, I'm learning something all the time.

Inteligentny - Intelligent

Ambitny - Ambitious

Kreatywny - Creative

Odważny - Brave

Energiczny - Energetic

Trudno mówić o sobie - It's hard to talk about yourself

Pracowity - Hardworking

Wiesz kiedy musisz odpoczywać - You know when you need to rest

Spokojny -Calm

Nie jestem nerwowy, agresywny - I'm not nervous, aggressive

Masz dużo plusów - You have a lot of pros

Wady - Disadvantages

Kłamać - To lie

Inna osoba zna moje wady - Another person knows my disadvantages

Nie lubię sprzątać - I do not like cleaning

Nie jestem leniwy - I am not lazy

Roztrzepana - Scatterbrained

Nie pamiętam, nie wiem gdzie co jest - I do not remember, I do not know where sometning is

Nie wiem gdzie jest portfel, klucze, telefon - I don't know where is the wallet, keys, phone

Jestem roztrzepany - I am scatterbrained

Jestem zbyt emocjonalny - I'm too emotional

Autoprezentacja - Self-presentation

Dużo plusów - A lot of pros

Mało minusów - Few cons

Energiczna - Energetic

Pozytywna - Positive

Jacy Wy jesteście? Napiszcie cechy charakteru - What are you like? Write your features.

If you would like Skype lessons from kamila please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

View Details

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

New Awakening Podcast just released https://anchor.fm/roy-coughlan0

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Ładna pogoda Nice weather

Wakacje w Polsce Holiday in Poland

Dzieci nie chodzą do szkoły Children don’t go to school

Specjalna lekcja A special lesson

Zwierzęta Animals

Zwierzęta domowa Pets

Lubisz zwierzęta? Do you like animals?

Jakie zwierzęta lubisz? What animals do you like?

To jest pies This is a dog

Mam psa I have a dog

Czy masz psa? Tak, mam psa. Do you have a dog? Yes, I have a dog.

Lubię psa, kota, królika I like a dog, cat, rabbit

Ludzie mają chomika People have a hamster

To jest chomik, mam chomika This is a hamster, I have a hamster

A czy Ty masz jakieś zwierzę domowe? Do you have any pet?

Miałem psa i kota I had a dog and cat

Jak miał na imię Twój pies i kot? What was your dog and cat's name?

Jak wyglądał Twój pies? Jaki miał kolor, czy był duży?

What did your dog look like? What color was it, was it big?

Kundelek, normalny pies Mongrel, a normal dog

Był czarny i biały It was black and white

Kundelek Rocky Rocky mongrel

Pierwszy kot był czarny i miał żółte oczy The first cat was black with yellow eyes

Drugi kot był rudy The second cat was red

Zwierzęta mają sierść The pets have fur

Na dywanie jest dużo sierści There is a lot of fur on the carpet

Alergia na sierść Fur allergy

Masz alergię na sierść? Are you allergic to fur?

Moja mama ma psa, małego czarnego psa, ma na imię Julia.

My mother has a dog, a little black dog, her name is Julia.

To jest Jork, mały pies This is York, a small dog

Nie planuje mieć zwierząt, nie mam czasu I don't plan to have pets, I don't have time

A czy Wy macie psa, kota, może chomika, kanarka?

Do you have a dog, a cat, maybe a hamster or a canary?

Mój brat ma żółwia My brother has a turtle

Napiszcie czy macie jakieś zwierzę Please write if you have any pet

If you would like Skype lessons from kamila please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Awakening Podcast/ Polish Property & business Offers - http://roycoughlan.com/

View Details

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

Zawsze uśmiechnięty - Always smiling

Dlaczego uczysz się polskiego? - Why do you learn Polish?

Mieszkam tutaj - I live here

Dlaczego ludzie uczą się polskiego? - Why do people learn Polish?

Bo mieszkają w Polsce - Because they live in Poland

Motywacja numer 1 - Motivation number 1

Praca - Work

Ludzie pracują w Polsce - People work in Poland

Motywacja numer 2 - Motivation number 2

Mąż, żona, chłopak albo dziewczyna są z Polski - A husband, wife, boyfriend or girlfriend are from Poland

Miłość -Love

Motywacja numer 3 - Motivation number 3

Ludzie chcą studiować w Polsce - People want to study in Poland

W Polsce są bardzo dobre uniwersytety - There are very good universities in Poland

Studia są tańsze - Studies are cheaper

Motywacja numer 4 - Motivation number 4

Ludzie chcą uczyć się innego języka - People want to learn a different language

Poliglota to osoba, która zna dużo języków - Polyglot is a person who knows many languages

Języki obce to pasja - Foreign languages are passion

Motywacja numer 5 - Motivation number 5

Ktoś z rodziny jest z Polski - Someone from the family is from Poland

Why do You learn Polish language? -What is your reason?

Dlaczego Wy uczycie się języka polskiego? Jaki jest Wasz powód?

If you would like Skype lessons from kamila please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Polish Property & business Offers - http://roycoughlan.com/

View Details

All Polish Episodes / Speaking Podcast / Meditation Podcast / Polish Property Offers - http://roycoughlan.com/

If you would like Skype lessons from kamila please visit http://polonuslodz.com

In this Episode we talked about:

Jesteś szczęśliwy? - Are you happy?

Specjalny temat - A special topic

Telewizja i kino - Television and cinema

Lubisz telewizję? - Do You like television (TV)?

Lubisz kino? - Do You like cinema?

Woleć - To prefer

Ja wolę - I prefer

Ty wolisz - You prefer

Co wolisz? Telewizję czy kino? - What do you prefer? TV or cinema?

Zależy - It depends

Wolisz chodzić do kina - You prefer to go to the cinema

W kinie jest lepszy dźwięk - There is a better sound in the cinema

Ekran jest większy - The screen is bigger

Duży ekran, dobry dźwięk - Big screen, good sound

Lubisz popcorn? - Do you like popcorn?

Ty też lubisz Coca Colę - You also like Coca Cola

Nie piję Coca Coli - I don't drink Coca Cola

Popcorn - Popcorn

Jakie są plusy oglądania telewizji w domu? - What are the pros of watching TV at home?

Światło telefonu w kinie - Phone light in the cinema

Ludzie rozmawiają - People are talking

Mogę zastopować film - I can stop the movie

W domu jest kameralnie, cicho, intymnie, nie ma ludzi - At home is intimate, quiet, there are no people

Czasami wolę oglądać w domu niż w kinie - Sometimes I prefer to watch at home than in the cinema

Ja nie oglądam filmów, ani w kinie ani w telewizji - I don't watch movies, neither in the cinema nor on television

Myślę, że lepiej oglądać w domu - I think it's better to watch at home

Nie ma ludzi, jest kameralnie - There are no people, it's intimate

Dziecko lubi chodzić do kina - The child likes going to the cinema

A Wy, wolicie kino czy telewizję? - Do you prefer cinema or television?

If you would like Skype lessons from kamila please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Polish Property Offers - http://roycoughlan.com/

View Details

All Polish Episodes / Speaking Podcast / Meditation Podcast / Polish Property Offers - http://roycoughlan.com/

If you would like Skype lessons from kamila please visit http://polonuslodz.com

In this Episode we discussed:

Plusy (zalety) Pros (advantages)

Wady (minusy) Disadvantages (cons)

Jakie są plusy Internetu? What are the pros of the Internet?

Edukacja przez Internet Internet education

Szukać informacji, wiadomości To look for information, news

Możemy słuchać muzyki We can listen to the music

Możemy oglądać edukacyjne filmy We can watch educational videos

Możemy oglądać filmy jak coś naprawić We can watch movies how to fix something

Możemy pracować przez Internet We can work via the Internet

Możemy robić podcasty We can do podcasts

Możemy robić zakupić przez Internet We can make shopping online

Możemy płacić rachunki We can pay bills

Jakie są wady? What are the disadvantages?

Jest spam There is spam

Media społecznościowe Social media

Uzależniony Addicted to

Możesz być uzależniony od Internetu You may be addicted to the Internet

Kim jest hacker? Who is a hacker?

Zabiera Twoje informacje, pieniądze z konta internetowego

Takes your information, money from an online account

Mogą boleć oczy Your eyes may hurt

Specjalny monitor Special monitor

Gry są niedobre dla dzieci Games are not good for children

Pornografia w Internecie Internet pornography

Jak macie pomysły, jakie są zalety i wady Internetu napiszcie w komentarzu

If you have ideas, what are the advantages and disadvantages of the Internet, write in a comment

If you would like Skype lessons from kamila please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Polish Property Offers - http://roycoughlan.com/

View Details

All Polish Episodes / Speaking Podcast / Meditation Podcast / Polish Property Offers - http://roycoughlan.com/

If you would like Skype lessons from kamila please visit http://polonuslodz.com

In this Episode we discussed:

Co u Ciebie? How are You?

O czym będziemy rozmawiać? What are we going to talk about?

Czego nie lubisz pić? What don't you like to drink?

Trudne pytanie Difficult question

Nie lubię pić wódki I don't like drinking vodka

Nie lubię pić alkoholu I don't like drinking alcohol

Czego nie lubisz jeść? What don't you like to eat?

Nie lubię jeść pierogów I don't like to eat dumplings

Pierogi z serem, z warzywami Dumplings with cheese, vegetables

Czego nie lubisz robić? What don't you like to do?

Nie lubię sprzątać w domu I don't like cleaning the house

Czego nie lubisz gotować? What don't you like to cook?

Nie lubisz gotować jedzenia, które gotujesz dużo czasu

You don't like cooking food that you cook a long time

Rosół Chicken soup

Czego nie lubisz oglądać? What don't you like to watch?

Nie lubię oglądać wiadomości I don't like watching the news

Masz pytanie do mnie? Do you have a question for me?

Czego nie lubisz pić? What don't you like to drink?

Nie lubię pić alkoholu, alkohol jest niezdrowy I don't like drinking alcohol, alcohol is unhealthy

Sok winogronowy Grape juice

Nie lubię jeść mięsa I don't like eating meat

Jestem wegetarianką, nie jem mięsa I'm a vegetarian, I don't eat meat

Rano jem jajecznice, owsiankę In the morning I eat scrambled eggs, porridge

Nie lubię sprzątać, zmywać I don't like cleaning or washing up

Napiszcie w komentarzu czego nie lubicie robić, jeść, pić, oglądać

Write in the comment what don't you like to do, eat, drink, watch

If you would like Skype lessons from kamila please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Polish Property Offers - http://roycoughlan.com/

View Details

All Polish Episodes / Speaking Podcast / Meditation Podcast / Polish Property Offers - http://roycoughlan.com/

If you would like Skype lessons from kamila please visit http://polonuslodz.com

In this Episode we discussed:

O czym lubisz rozmawiać? - What do you like to talk about?

Rozmawiać godzinami - Talk for hours

Ja lubię rozmawiać o tym, jak mógłbym zmienić świat na lepszy - I like to talk about how I could change the world for the better

O medytacji i o jodze - About meditation and yoga (www.meditationpodcast.org)

Lubisz polskie romantyczne komedie? - Do you like Polish romantic comedies?

Słucham też radio - I also listen to the radio

Reklama - Advertisement

Nie chcę słuchać negatywnych informacji - I don't want to listen to negative information

Czy teraz czytasz jakieś książki? - Do you read any books now?

Marketing - Marketing

Czy masz jakieś plany na ten weekend? - Do you have any plans for this weekend?

Ja będę robił kilka podcastów i odpoczywał - I will make a few podcasts and rest

Czy Ty odżywiasz się zdrowo? - Do you eat healthy food?

Jaka jest Twoja dieta? - What is your diet?

Nie jesz pizzy, hot dogów, hamburgerów - You don't eat pizza, hot dogs, hamburgers

Umiesz gotować? Co gotujesz? - Can You cook? What do You cook?

Na śniadanie gotuję jajecznicę - I cook scrambled eggs for breakfast

Na obiad gotuję kaczkę - I cook a duck for dinner

Mięso plus warzywa - Meat plus vegetables

Jakie są Twoje trzy marzenia ? - What are your three dreams?

Marzenie numer 1: budować idealny dom - Dream number 1: to build the perfect home

Mam projekt domu - I have a house project

Marzenie numer 2: ja piszę książkę, tłumaczę ją na 20 języków, robimy fundację i zmienimy świat na lepsze I write a book, translate it into 20 languages, we make a foundation and change the world for the better

Marzenie numer 3: spotkam bratnią duszę - I will meet my soul mate

Chciałabym być szczęśliwa i zdrowa i żeby mój syn też był zdrowy, szczęśliwy i grzeczny I would like to be happy and healthy and that my son also would be healthy and happy and polite

Jakie Wy macie marzenia? - What are your dreams?

If you would like Skype lessons from kamila please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Polish Property Offers - http://roycoughlan.com/

View Details

All Polish Episodes / Speaking Podcast / Meditation Podcast / Polish Property Offers - http://roycoughlan.com/

If you would like Skype lessons from kamila please visit http://polonuslodz.com

Jak się relaksować? - How to relax?

Dzisiaj czuję się zrelaksowany - I feel relaxed today

Jak możemy relaksować się? - How can we relax?

Co możemy robić? - What can we do?

Jakie masz pomysły? - What ideas do You have?

Możemy leżeć i czytać książkę - We can lie and read a book

Możemy spać - We can sleep

Możemy leżeć na słońcu i opalać się - We can lie in the sun and sunbathe

Możemy wypić kieliszek dobrego wina - We can drink a glass of good wine

Możemy obejrzeć telewizję, serial, film - We can watch TV, series, film

Możemy Iść do restauracji - We can go to the restaurant

Możemy jechać na wycieczkę - We can go on a trip

Możemy spacerować w lesie - We can walk in the wood

Możemy czytać książkę - We can read a book

Medytacja - Meditaion

Możemy medytować - We can meditate (www.meditationpodcast.org)

Możemy wziąć relaksacyjną kąpiel - We can take a relaxing bath

Możemy pójść na spacer do parku - We can go for a walk in the park

Możemy posłuchać relaksacyjnej muzyki - We can listen to relaxing music

Jakie są Wasze metody na relaks? - What are your methods to relax?

Co robicie jak chcecie się zrelaksować? - What do you do when you want to relax?

If you would like Skype lessons from kamila please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Polish Property Offers - http://roycoughlan.com/

View Details

All Polish Episodes / Speaking Podcast / Meditation Podcast / Polish Property Offers - http://roycoughlan.com/

If you would like Skype lessons from kamila please visit http://polonuslodz.com

At the Dentist - U dentysty

How do you feel - Jak się czujesz

Not good, my tooth hurts - Nie dobrze, boli mnie ząb

Tooth / Teeth - Ząb zęby

That's a big problem - To duży problem

Does your tooth hurt or your teeth? - Czy boli Cię ząb czy zęby?

The construction is my tooth hurts - Konstrukcja to boli mnie ząb

Oh that's not very good - Och, to nie jest zbyt dobre

What is your problem - Jaki masz problem

I have a half tooth - Mam pół zęba

I think I ate the other half :) - Myślę, że zjadłem drugą połowę :)

Lots of chocolate/lots of sugar - Dużo czekolady / dużo cukru

So we will be doing a dialogue at the Dentists - Więc będziemy prowadzić dialog u dentystów

Good morning - Dzień dobry

What is your problem - Jaki masz problem

My tooth pains me - Boli mnie ząb

I have a half tooth - Mam pół zęba

How much will it cost to fix - Ile to kosztuje naprawić

To fix the tooth, it depends - To zależy od zęba

Here is the price list - Oto cennik

Please have a look - Proszę spojrzeć

Drilling - Wiercenie

I don't like drilling very much - Nie bardzo lubię wiercić

Do you like drilling - Czy lubisz wiercić?

I don't have a problem - Nie mam problemu

Sometimes I sleep at the dentist - Czasami śpię u dentysty

That's interesting - To interesujące

How much does it cost to drill - Ile kosztuje wiercić

Drilling costs 50zl - Wiercenie kosztuje 50 zł

I have yellow teeth and I want white teeth - Mam żółte zęby i chcę białe zęby

Whiting your teeth costs 300zl - Whiting zęby kosztuje 300 zł

Very expensive - Bardzo drogi

They can be yellow :) - Mogą być żółte :)

The next offer is sanding teeth, Polishing - Kolejna oferta to szlifowanie zębów, polerowanie

The next offer is fillings - Następna oferta to wypełnienia

Do you have fillings - Czy masz nadzienia?

I had mercury fillings and they are not healthy - Miałem rtęć i nie są zdrowe

5 years ago I changed to white - 5 lat temu zmieniłem się na biały

I have 4 white fillings - Mam 4 białe wypełnienia

and you - a ty

Also 4 - Również 4

Next is the last offer - Następna jest ostatnia oferta

Pull out your tooth - Wyciągnij ząb

That's very painful - To bardzo bolesne

If it really pains please give me an anesthetic - Jeśli to naprawdę boli, daj mi środek znieczulający

What is the offer - Jaka jest oferta

I will speak in Polish and you will speak in English - Będę mówić po polsku, a ty mówisz po angielsku

Drill - Wiercić

Whitening your teeth - Wybielanie zębów

Polishing your teeth - Polerowanie zębów

Pulling out your tooth - Wyciągając ząb

Anesthetic - Znieczulający

Now we will have a dialogue - Teraz będziemy mieć dialog

I am the Dentist and you are the patient on the telephone - Jestem dentystą, a ty pacjentem przez telefon

Good morning - Dzień dobry

I have a problem - mam problem

Yes, everyone that phones has a problem - Tak, każdy telefon ma problem

My tooth pains me - Boli mnie ząb

Very much - Bardzo

Yes, I can't sleep - Tak, nie mogę spać

I understand - rozumiem

I would like to make an appointment - chciałbym umówić spotkanie

Good, when have you time? - Dobrze, kiedy masz czas?

Now - Teraz

Unfortunately now we have a lot of patients - Niestety teraz mamy wielu pacjentów

It can be tomorrow afternoon - Może być jutro po południu.

Have you time tomorrow afternoon? - Czy masz czas na jutrzejsze popołudnie?

Yes, aybe at 2pm - Tak, może być o 14.00

ok, see you tomorrow at 2pm - ok, do zobaczenia jutro o 14.00

We will see what is the problem - Zobaczymy na czym polega problem

We have an anesthetic so it will not hurt - Mamy znieczulenie, więc nie będzie bolało

ok Super - ok Super

See you tomorrow - Do zobaczenia jutro

If you would like Skype lessons from kamila please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Polish Property Offers - http://roycoughlan.com/

View Details

All Polish Episodes / Speaking Podcast / Meditation Podcast / Polish Property Offers - http://roycoughlan.com/

If you would like Skype lessons from kamila please visit http://polonuslodz.com/

How is your job - Jaka jest twoja praca

Nothing new - Nic nowego

All the time at home - Cały czas w domu

and what are you doing at home - i co robisz w domu

Reading a book - Czytając książkę

and are you working - i pracujesz

yes - tak

Good as today we talk about work - Dobrze, że dziś mówimy o pracy

What is your job - Jaka jest twoja praca

Is it interesting / boring / satisifying - Czy to interesujące / nudne / satysfakcjonujące

or for example work can be difficult - lub na przykład praca może być trudna

Work can be tiring - Praca może być męcząca

and my question, what is your work? - i moje pytanie, jaka jest twoja praca?

My work is different - Moja praca jest inna

for example Podcasting as I have 3 Podcasts - na przykład Podcasting, ponieważ mam 3 podcasty

Work No.1 is interesting - Praca nr 1 jest interesująca

No. 2 I write a few books - Nr 2 Piszę kilka książek

At the same moment you write a few books? - W tym samym momencie piszesz kilka książek?

Yes, it's interesting for me as I know it will help people - Tak, jest to dla mnie interesujące, ponieważ wiem, że pomoże ludziom

Writing books is interesting - Pisanie książek jest interesujące

Work No.3 is Real Estate - Praca nr 3 dotyczy nieruchomości

Are you an agent / property developer - Czy jesteś agentem / deweloperem?

How is that type of work - Jak tam ten rodzaj pracy

Stressful - Stresujący

Sometimes it can be for me. - Czasami może to być dla mnie.

I really like building a block from a field - Naprawdę lubię budować blok z pola

New building - Nowy budynek

or a renovation is satisifying - lub remont jest satysfakcjonujący

But when I have documentation, government or accountant work, I get very tired - Ale kiedy mam dokumentację, pracę rządu lub księgowego, jestem bardzo zmęczony

That is not work for me - To nie działa dla mnie

Solicitors and Court - Adwokaci i sądy

That work is stressful and tiring - Ta praca jest stresująca i męcząca

My work is super - Moja praca jest super

Being a teacher is interesting - Bycie nauczycielem jest interesujące

It gives a lot of satisifaction - Daje dużo satysfakcji

Because I can meet interesting people from different countries - Ponieważ mogę poznać ciekawych ludzi z różnych krajów

Do you understand - Czy rozumiesz

I understand - rozumiem

Different cultures, different traditions - Różne kultury, różne tradycje

It's very interesting - To bardzo interesujące

And now as you work from home, it can be from all the world - A teraz, gdy pracujesz w domu, może pochodzić z całego świata

Yes, now as it's a pandemic, corona virus, we work from home on Skype - Tak, teraz, ponieważ jest to pandemiczny wirus korony, pracujemy w domu na Skype

Work can be interesting, gives lots of satisfaction, stress and sometimes can be tiring - Praca może być interesująca, daje wiele satysfakcji, stresu, a czasem może być męcząca

Have a good work - Miłej pracy

If you would like Skype lessons from kamila please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Polish Property Offers - http://roycoughlan.com/

View Details

All Polish Episodes / Speaking Podcast / Meditation Podcast / Polish Property Offers - http://roycoughlan.com/

If you would like Skype lessons from kamila please visit http://polonuslodz.com/

41 Small Talk - # 41 Mała rozmowa

How are you - Jak się masz

I'm very good - jestem bardzo dobry

and how do you feel - i jak się czujesz

Fantastic - Fantastyczny

Beautiful weather, sunny - Piękna pogoda, słonecznie

Today is very beautiful weather - Dziś jest bardzo piękna pogoda

It's warm - Jest ciepło

What is the temperature - Jaka jest temperatura

15 degrees - 15 stopni

What is your plan on this sunny day - Jaki masz plan na ten słoneczny dzień?

In the morning I had breakfast with my son in the garden - Rano zjadłem śniadanie z synem w ogrodzie

Later we played football - Później graliśmy w piłkę nożną

Do you play other sports - Czy uprawiasz inne sporty?

With my son? - Z moim synem?

No, in general - Nie, ogólnie

I play squash - Gram w squasha

But unfortunately I can not play now as the gyms are closed because of the virus - Ale niestety nie mogę teraz grać, ponieważ sale gimnastyczne są zamknięte z powodu wirusa

Now is the Corona virus and all gyms are closed - Teraz jest wirus Corona i wszystkie siłownie są zamknięte

What kind of sport do you like the most - Jaki sport lubisz najbardziej?

What is your plan for the weekend - Jaki masz plan na weekend?

In the weekend I will be reading a book and playing with my son - W weekend będę czytać książkę i bawić się z moim synem

and how does your house look - i jak wygląda twój dom

Is it small,big, pretty , new or old? - Czy to jest małe, duże, ładne, nowe czy stare?

It's pretty and big - Jest ładny i duży

Have you got lots of rooms? - Masz dużo pokoi?

5 rooms and the kitchen - 5 pokoi i kuchnia

Are you far from the city centre? - Czy jesteś daleko od centrum miasta?

I am 15 minutes by car from the city centre - Jestem 15 minut samochodem od centrum miasta

How does your office look? - Jak wygląda twoje biuro?

Now I have my office in home - Teraz mam swoje biuro w domu

Oh thats comfortable, office at home - Och, to wygodne, biuro w domu

Super - Wspaniały

How does it look - Jak to wygląda

Lots of books? - Mnóstwo książek?

Yes I have 700 books - Tak, mam 700 książek

700 books , wow - 700 książek, wow

Thats a lot - To dużo

Do you have a table - Czy masz stolik?

Yes with computer, microphone and chair - Tak, z komputerem, mikrofonem i krzesłem

Do you like learning Polish - Czy lubisz uczyć się polskiego?

Yes - Tak

A lot? - Dużo?

Sometimes - Czasami

What season is it now Roy? - Który sezon jest teraz Roy?

Spring - Wiosna

It's beautiful spring - To piękna wiosna

I wish you a nice day, lots of sun and relaxation - Życzę miłego dnia, dużo słońca i relaksu

Same to you - Nawzajem

Have a nice day - Miłego dnia

If you would like Skype lessons from kamila please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Polish Property Offers - http://roycoughlan.com/

View Details

All Polish Episodes / Speaking Podcast / Meditation Podcast / Polish Property Offers - http://roycoughlan.com/

If you would like Skype lessons from kamila please visit http://polonuslodz.com/

Hi Kamila - Cześć Kamila

How are you - Jak się masz

What are we doing today - Co dzisiaj robimy

Today we will make cupcakes - Dzisiaj zrobimy babeczki

Do you like cupcakes - Czy lubisz babeczki?

I like cupcakes - Lubię babeczki

What is that - Co to jest

It is a bowl - To jest miska

Flour - Mąka

This is flour - To jest mąka

1.5 glasses of flour - 1,5 szklanki mąki

Please repeat - Proszę powtórzyć

3/4 Glass os sugar - 3/4 Szklany cukier os

Brown or white sugar - Brązowy lub biały cukier

Better brown as white is not healthy - Lepiej brązowy, ponieważ biały nie jest zdrowy

Next a small spoon - Następnie mała łyżeczka

oil - olej

1/2 glass of oil - 1/2 szklanki oleju

Now we can add a couple of drops of orange flavouring - Teraz możemy dodać kilka kropli aromatu pomarańczowego

Vinegar - Ocet winny

1 spoon of vinegar - 1 łyżka octu

Now we mix - Teraz miksujemy

Now we bake - Teraz pieczemy

What is that - Co to jest

An oven - Piekarnik

Please repeat - Proszę powtórzyć

What temperature - Jaka temperatura

180 degrees - 180 stopni

How long do we bake - Jak długo pieczemy

1/2 hr - 1/2 godz

25 mins - 25 minut

Will you wait - Poczekasz

Gladly with my tea - Chętnie z moją herbatą

If you would like Skype lessons from kamila please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Polish Property Offers - http://roycoughlan.com/

View Details

All Polish Episodes / Speaking Podcast / Meditation Podcast / Polish Property Offers - http://roycoughlan.com/

If you would like Skype lessons from kamila please visit http://polonuslodz.com/

In the kitchen - W kuchni

How are you - Jak się masz

I am good - jestem dobry

We are now in my kitchen - Jesteśmy teraz w mojej kuchni

What does that mean - Co to znaczy

My kitchen - Moja kuchnia

Do you want tea - Chcesz herbatę?

Of course - Oczywiście

Yes please - tak proszę

Do you know how to make tea in Polish - Czy wiesz, jak zrobić herbatę po polsku?

What is that - Co to jest

A kettle - Czajnik

This is a kettle - To jest czajnik

Take the kettle - Weź czajnik

Pour water - Wlać wodę

Boil water - Zagotować wodę

For you will be tea - Bo będziesz herbatą

What is that - Co to jest

A mug - Kubek

What type of tea do you like - Jaki rodzaj herbaty lubisz

Fruit - Owoc

I will see if I have - Zobaczę, czy mam

or black tea - lub czarna herbata

I dont have black tea as I dont drink black tea - Nie mam czarnej herbaty, ponieważ nie piję czarnej herbaty

I have herbal tea - Mam herbatę ziołową

Later you will be calm and relaxed - Później będziesz spokojny i zrelaksowany

Do you want herbal tea - Chcesz herbatę ziołową?

No I can meditate to relax - Nie, mogę medytować, aby się zrelaksować

It can be - To może być

Do you know what that is? - Czy wiesz co to jest?

A dishwasher - Zmywarka

I will now wash dishes - Teraz umyję naczynia

Do you know dishes in Polish - Czy znasz potrawy po polsku?

Plate / Pot / Frying pan - Talerz / Garnek / Patelnia

Mug / Glass - Kubek / Szkło

and what is that? - I co to jest?

A spoon - Łyżka

Small spoon / spoon - Mała łyżka / łyżka

Knife - Nóż

You know everything - Ty wiesz wszystko

I am very happy - jestem bardzo szczęśliwy

and what about our students? - a co z naszymi studentami?

If you would like Skype lessons from kamila please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Polish Property Offers - http://roycoughlan.com/

View Details

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

What will we be talking about today - O czym dzisiaj będziemy rozmawiać

Shopping centre - Centrum handlowe

What type of shops - Jaki rodzaj sklepów

Book shop - Księgarnia

Jewelery shop - Sklep jubilerski

Hairdressors - Fryzjer

Do you go to the hairdressors in the shopping centre - Idziesz do fryzjerów w centrum handlowym

In the shopping centre, no - W centrum handlowym nie

Travel agency - Biuro podróży

What else - Co jeszcze

Pharmacy - Apteka

Roy does not know - Roy nie wie

Something sweet - Coś słodkiego

Cosmetics - Kosmetyki

Tea shop / Coffee shop - Herbaciarnia / kawiarnia

kiosk - kiosk

Flower shop - Kwiaciarnia

Shoe shop -Sklep obuwniczy

Clothes shop - Sklep odzieżowy

Bread shop - Piekarnia

Roy, where can you buy a red rose - Roy, gdzie możesz kupić czerwoną różę

In the flower shop - W kwiaciarni

Cough medicine, In the pharmacy - Lek na kaszel - w aptece

Please repeat - Proszę powtórzyć

Where can I buy good soap - Gdzie mogę kupić dobre mydło?

Cosmetic shop - Sklep kosmetyczny

Where can I buy a t-shirt - Gdzie mogę kupić koszulkę?

Where can yo buy fresh bread - Bread shop - Gdzie można kupić świeży chleb - sklep z pieczywem

Where can you buy nice boots - Shoe shop - Gdzie można kupić ładne buty - sklep obuwniczy

Where can you buy a book - The book shop - Gdzie można kupić książkę - Księgarnia

Where can you buy a silver necklace - In the jewelers - Gdzie można kupić srebrny naszyjnik - U jubilerów

Where can you buy a trip to Spain - In the travel agency - Gdzie można kupić wycieczkę do Hiszpanii - w biurze podróży

Today we are finished as I can see you are tired. - Dzisiaj jesteśmy skończeni, bo widzę, że jesteś zmęczony.

If you would like Skype lessons from kamila please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Polish Property & business Offers - http://roycoughlan.com/

View Details

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this Episode we discuss:

How is your voice - Jaki jest twój głos

I am a little sick - jestem trochę chory

Would you like some tea - Czy chcesz może herbaty

To thanks - Dzięki

Announcement in the newspaper - Ogłoszenie w gazecie

Announcement in the internet - Ogłoszenie w Internecie

Foreigner - Cudzoziemiec

Looking - Szukam

I am/You are/ he,she is/We are/they are - Ja jestem / Ty jesteś / on, ona jest / My jesteśmy / oni są

I am looking for an apartment - Szukam mieszkania

1 room / 2 rooms / 3 rooms - 1 pokój / 2 pokoje / 3 pokoje

With a bathroom - Z łazienką

Bedroom with a bed - Sypialnia z łóżkiem

I am looking for 100m2 apartment with 2 bedrooms - Szukam mieszkania o powierzchni 100 m2 z 2 sypialniami

Open plan kitchen saloon - Otwarty salon kuchenny

and a garage for my car - i garaż na mój samochód

Ooh a big apartment - Ooh, duże mieszkanie

or a house - lub dom

After renovation - Po renowacji

for renovation - do renowacji

I am looking for an apartment 4 rooms with a garage - Szukam mieszkania 4 pokoje z garażem

In the centre of the city - W centrum miasta

20 mins from the city driving - 20 minut jazdy samochodem od miasta

Apartment / House / Semi-detached / terraced house - Apartament / Dom / Bliźniak / dom szeregowy

To rent - Do wynajęcia

Close to the centre - Blisko centrum

With a balcont / terrace - Z balkonem / tarasem

I do not like sleeping in the saloon - Nie lubię spać w salonie

In Ireland we always have a bedroom - W Irlandii zawsze mamy sypialnię

In Poland a lot of people like this - W Polsce wielu takich ludzi lubi

Garden - Ogród

I like grass and trees - Lubię trawę i drzewa

I don't like cutting grass - Nie lubię ścinać trawy

Gardening is a lot of work - Ogrodnictwo to dużo pracy

Thank you - Dziękuję Ci

Good luck - Powodzenia

If you would like Skype lessons from kamila please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Polish Property & business Offers - http://roycoughlan.com/

View Details

To listen to all Episodes + The Speaking Podcast + The Meditation Podcast + Business Opportunities please visit http://roycoughlan.com/

To get Skype lessons from Kamila or her team please visits http://polonuslodz.com/

In this weeks Episode we discussed:

Why not - Dlaczego nie

Today we will talk about furniture in the house - Dziś porozmawiamy o meblach w domu

e.g. that's a table - na przykład to jest stół

Chair / Lamp / Curtain / Couch - Krzesło / Lampa / Zasłona / Kanapa

Sandwich and Couch - Kanapka i Kanapa

Armchair / Cupboard - Fotel / Szafka

Bed / Wardrobe - Łóżko / szafa

What is in your lounge - Co jest w twoim salonie

I have an open Kitchen Lounge - Mam otwarty salon kuchenny

TV / Table / Kitchen table - TV / Stół / Stół kuchenny

You have a small table - Masz mały stolik

I have an office desk - Mam biurko

Office chair / Clock / Cupboard - Krzesło biurowe / zegar / szafka

And what is there? - A co tam jest

A bedroom - Sypialnia

What is in the bedroom - Co jest w sypialni

A bed / a bedside lamp - Łóżko / lampka nocna

Bedside table - Stolik nocny

What is in the kitchen - Co jest w kuchni

Fridge / Oven / Electricity or Gas - Lodówka / Piekarnik / Elektryczność lub Gaz

Kitchen unit - Jednostka kuchenna

Electrical kettle - Czajnik elektryczny

What's in the bathroom - Co jest w łazience

Bath / Shower / Toilet / bidet - Wanna / prysznic / toaleta / bidet

Sink and a large mirror - Zlew i duże lustro

If you would like Skype lessons from kamila please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Polish Property & business Offers - http://roycoughlan.com/

View Details

All Episodes along with the Speaking Podcast & the Meditation Podcast can be found at http://roycoughlan.com/

If you would like Skype lessons from kamila please visit http://polonuslodz.com/

This Weeks Episode:

How do you feel - Jak się czujesz

I am happy - jestem szczęśliwy

What is the topic today - Jaki jest dzisiaj temat

Today we will talk about wishes - Dzisiaj porozmawiamy o życzeniach

Different Occasions - Różne okazje

example Birthday - przykład Urodziny

Name day - Imieniny

When is your birthday - Kiedy są twoje urodziny

4th October 1972 - 4 października 1972 r

How old are you - Ile masz lat

47 forty seven - czterdzieści siedem

and you? - a ty?

When have I my birthday - Kiedy mam urodziny

I have my birthday in July - Mam urodziny w lipcu

I am 33 years already - Mam już 33 lata

When is your name day - Kiedy masz na imie?

It's the same 18th July - To jest tego samego 18 lipca

I only get one present always - Zawsze dostaję tylko jeden prezent

I don't have a name day - Nie mam imienin

Ireland does not have a name day - Irlandia nie ma imienin

It's a Polish tradition - To polska tradycja

When people have birthday's or name's day we give wishes - Kiedy ludzie mają urodziny lub imieniny, składamy życzenia

Give wishes - Daj życzenia

What type of wishes - Jakie życzenia

All the best - Wszystkiego najlepszego

Lots of health - Dużo zdrowia

Lots of happiness - Dużo szczęścia

Lots of love - Dużo miłości

Lots of money - Dużo pieniędzy

Lots of success - Dużo sukcesów

What other types of wishes can be - Jakie inne rodzaje życzeń mogą być

What do you say - Co mówisz

Happy Birthday - Wszystkiego najlepszego

Maybe we sing together - Może śpiewamy razem

In Poland there is a tradition that for name's day or birthday we sign one hundred years - W Polsce istnieje tradycja, że na imieniny lub urodziny podpisujemy sto lat

Again at weddings they sing - Ponownie na weselach śpiewają

I have a birthday and what wishes could you give me - Mam urodziny i jakie życzenia możesz mi dać

Happy Birthday - Wszystkiego najlepszego

Have a nice day - Miłego dnia

lots of health / love / money / satisfaction - dużo zdrowia / miłości / pieniędzy / satysfakcji

If you would like Skype lessons from kamila please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Polish Property & business Offers - http://roycoughlan.com/

View Details

Today we will talk about Valentine's day - Dzisiaj porozmawiamy o Walentynkach

Tomorrow is Valentine's day - Jutro są Walentynki

I Love You - Kocham Cię

I like you - lubię cię

I like your appearance - Podoba mi się twój wygląd

You are beautiful - Jesteś piękna

You are pretty - Jesteś ładna

You are amazing - Jesteś niesamowity

You are wonderful - Jesteś wspaniały

You have beautiful eyes - Masz piękne oczy

You have a beautiful smile - Masz piękny uśmiech

Your hair is very beautiful - Twoje włosy są bardzo piękne

You are very handsome - Jesteś bardzo przystojny

I know - wiem

You are very pretty - Jesteś bardzo ładna

14th of February - 14 lutego

Tomorrow is Valentine's day - Jutro są Walentynki

You can buy a card and write I love you - Możesz kupić kartę i napisać, że Cię kocham

You are very pretty - Jesteś bardzo ładna

You can buy flowers - Możesz kupić kwiaty

A rose - Róża

and Roy are you buying a rose tomorrow - a Roy kupujesz jutro różę

No I am single - Nie, jestem sam

Good grammer - Dobry gramatyk

You don't have a valentine - Nie masz walentynek

All the best of valentine's day to all our listeners - Wszystkiego najlepszego z okazji walentynek dla wszystkich naszych słuchaczy

If you would like Skype lessons from kamila please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Polish Property & business Offers - http://roycoughlan.com/

View Details

Do you like to travel - Czy lubisz podróżować

What is the Sea / Mountain - Co to jest morze / góra

Do you like the sea / mountains - Czy lubisz morze / góry

To Prefer - Woleć

I prefer / you prefer - Wolę / wolisz

Please repeat - Proszę powtórzyć

Roy what do you prefer - Roy, co wolisz

It depends on the weather and season - To zależy od pogody i pory roku

Please repeat with good grammar - Powtórz z dobrą gramatyką

ok we will learn the seasons - ok nauczymy się pór roku

Now is winter - Teraz jest zima

Spring / Summer / Autumn - Wiosna / lato / Jesień

In summer I prefer the sea - W lecie wolę morze

Why? What can we do at the sea - Dlaczego? Co możemy zrobić na morzu?

We can swim - Możemy pływać

What else - Co jeszcze

Build a sand castle - Zbudować zamek z piasku

Lay on the sand and sunbath - Połóż się na piasku i opalaj

Water sports - Sporty wodne

We can play volleyball - Możemy grać w siatkówkę

eat ice cream - jedz lody

In winter what can we do in the mountains - Zimą co możemy robić w górach

We can ski - Możemy jeździć na nartach

Walking and watch nature and animals - Chodzić i oglądać przyrodę i zwierzęta

It depends - To zależy

What else can we do in the mountains - Co jeszcze możemy zrobić w górach

Sleep in the tent - Spać w namiocie

I prefer hotels because there are not a lot of insects - Wolę hotele, ponieważ nie ma tam wielu owadów

How do you like to travel - Jak lubisz podróżować

Car / Bus / Train - Samochód / autobus / pociąg

I prefer by car - Wolę samochodem

To another city or place - Do innego miasta lub miejsca

Do you like to travel by train? - Czy lubisz podróżować pociągiem?

Not really as now a lot of people talk on mobile phones and you can't concentrate - Nie tak, jak teraz wiele osób rozmawia przez telefony komórkowe i nie możesz się skoncentrować

I like to read - lubię czytać

Have a good day - Miłego dnia

If you would like Skype lessons from kamila please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Polish Property Offers - http://roycoughlan.com/

View Details

Welcome to the New Year - Witamy w Nowym Roku

How was your New Years Party - Jak minęła impreza noworoczna

Everything was good - Wszystko było dobrze

How was you New Years party? - Jak ci minęło przyjęcie noworoczne?

I was at home with my son because you had a party - Byłem w domu z moim synem, ponieważ miałeś imprezę

New Years Resolutions - Postanowienia noworoczne

What are your New Years Resolutions? - Jakie są twoje postanowienia noworoczne?

for me I always have a book that I write a list of goals that I want to do for the year - dla mnie zawsze mam książkę, w której piszę listę celów, które chcę zrobić na ten rok

What is your goal No.1? - Jaki jest twój cel nr 1?

Read 50 Books - Przeczytaj 50 książek

No.2 to do 26 online courses - Nr 2 na 26 kursów online

To do something like Polish online? - zrobić coś takiego jak polski online?

No something interesting - Nic ciekawego

Something that gives me energy and not take it - Coś, co daje mi energię i jej nie biorę

No. 3 I don't know. I do not have my list with me - Nr 3 nie wiem. Nie mam przy sobie mojej listy

Go to another country that I have never been to - Idź do innego kraju, w którym nigdy nie byłem

Cook 5 new dishes - Gotuj 5 nowych potraw

and you Kamila, what is your New Years Resolutions? - a wy Kamila, jakie są wasze postanowienia noworoczne?

My plan for the new year is less work / more rest - Mój plan na nowy rok to mniej pracy / więcej odpoczynku

To do more sport especially Yoga - Uprawiać więcej sportu, zwłaszcza jogę

I plan to do a Yoga course for being a Yoga instructor - Planuję zrobić kurs jogi jako instruktor jogi

More walking - Więcej chodzenia

More time in Nature - Więcej czasu w naturze

The most important plan - Najważniejszy plan

What are our students plans for the new year? - Jakie są plany naszych studentów na nowy rok?

Maybe less TV - Może mniej telewizji

Maybe less work - Może mniej pracy

Maybe to relax more - Może bardziej zrelaksować się

Maybe more sport - Może więcej sportu

Maybe less fast food - Może mniej fast foodów

Earn more money - Zarób więcej pieniędzy

Don't smoke cigarettes - Nie pal papierosów

or don't drink alcohol - lub nie pij alkoholu

or don't drink coffee - lub nie pij kawy

or don't take drugs - lub nie bierz narkotyków

So write what are your plans for the new year - Napisz więc, jakie masz plany na nowy rok

View Details

In this Episode you will learn: - W tym odcinku nauczysz się:

Warmly welcome - Serdecznie witamy

How are you - Jak się masz

I'm good and you - dobrze, a ty

What will we be talking about today - O czym dzisiaj będziemy rozmawiać

Christmas - Boże Narodzenie

Merry Christmas - Wesołych Świąt

Roy you don't have a Christmas tree - Roy, nie masz choinki

Better outside - Lepiej na zewnątrz

Decorate the tree - Udekoruj drzewo

In Poland people decorate trees - W Polsce ludzie dekorują drzewa

Angel - Anioł

On the top is a star - Na górze jest gwiazda

Christmas balls - Bombki choinkowe

Christmas lights - oświetlenie świąteczne

I have two Christmas trees, one in the saloon and the other in my sons room - Mam dwie choinki, jedną w salonie i drugą w pokoju moich synów

Students do you have a Christmas tree at home? - Studenci, czy macie w domu choinkę?

Happy New Year and Merry Christmas - Szczęśliwego Nowego Roku i Wesołych Świąt

We cook a lot - Dużo gotujemy

In Poland people generally cook dumplings - W Polsce ludzie zazwyczaj gotują pierogi

Turkey - indyk

Roast Potatoes - Pieczone ziemniaki

What is your main dish - Jakie jest twoje główne danie?

Mushroom soup with noodles - Zupa grzybowa z makaronem

Cabbage with peas - Kapusta Z Groszkiem

Carp fish - Karp

Presents - Przedstawia

Presents under the Christmas tree - Prezenty pod choinką

Polish tradition - Polska tradycja

Santa clause - Święty Mikołaj

Thank you for listening for the whole year - Dziękujemy za słuchanie przez cały rok

We will be back next year - Wrócimy w przyszłym roku

Merry Christmas and Happy New Year - Wesołych Świąt i Szczęśliwego Nowego Roku

If you would like Skype lessons from kamila please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Polish Property Offers - http://roycoughlan.com/

View Details

In this Episode you will learn:

Hi / Bye - Cześć, or bye can be pa Today we will talk about sport - Dzisiaj porozmawiamy o sporcie Do you like sport - Lubisz sport To do sport - Uprawiać sport How often do you play sport - Jak często uprawiasz sport Once a week - Raz w tygodniu Twice a week - Dwa razy w tygodniu

What type of sport - Jaki rodzaj sportu I play squash - Gram w squasha When the weather is good I cycle - Przy dobrej pogodzie jeżdżę na rowerze What else - Co jeszcze Do you swim - Pływasz I prefer to swim at the beach - Wolę pływać na plaży Ocean - Ocean I like to swim in the ocean - Lubię pływać w oceanie In the swimming pool - W basenie When I was young - Kiedy byłem młody Lots of swimming pools have chlorine and its not good for your skin - Wiele basenów ma chlor i nie jest dobry dla twojej skóry

What types of sport do you know - Jakie rodzaje sportu znasz? Martial Arts - Sztuki walki Maybe football - Może futbol Basketball - Koszykówka Volleyball / Tennis / Golf - Siatkówka / Tenis / Golf Badminton / Skiing / Ice Skating - Badminton / Narciarstwo / Łyżwiarstwo Rugby - Rugby Scuba Diving - Nurkowanie z akwalungiem Sky Diving - Spadochroniarstwo Extreme Sports - Sporty ekstremalne Parachute - Spadochron What sport do you like - Jaki sport lubisz I do not like to watch sport, I prefer to play - Nie lubię oglądać sportu, wolę grać Squash / Tennis / Martial Arts / Swimming - Squash / Tenis / Sztuki walki / Pływanie I like to run - lubię biegać Cycle - Cykl Do Yoga, its very good for your health and body - Uprawiaj jogę, która jest bardzo dobra dla zdrowia i ciała I like to play football with my son - Lubię grać w piłkę nożną z moim synem We were in the shop and he asked me to buy a basketball - Byliśmy w sklepie, a on poprosił mnie o zakup koszykówki and when you were young - a kiedy byłeś młody Boxing - Boks Its good for your head - To dobrze dla twojej głowy Students - What sports do you like best? - Studenci - Jakie sporty lubisz najbardziej?

If you would like Skype lessons from kamila please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Polish Property Offers - http://roycoughlan.com/

View Details

In this weeks Episode we discuss parts of the body:

dzień dobry - Good day

Jak się masz - How are you

bardzo dobrze - very good

dziś dużo intensywnej pracy, ale bardzo przyjemna - today a lot of intensive work but very nice

a ty - and you

także dobre - also good

ponieważ masz lekcję polskiego - because you have a Polish lesson

i lubisz się uczyć - and you like to learn

oczywiście - of course

Twoją pasją i hobby jest nauka polskiego - your passion and you hobby is to learn polish

oczywiście - of course

Zobacz, znam cię - See I know you

Dzisiaj poznamy części ciała - Today we will learn parts of the body

Ty wiesz wszystko - You know everything

Części samochodu / komputera - Parts of the car / computer

Mam trudny dzień - I have a difficult day

Co to jest - What is that

Włosy / głowa / czoło / brwi - Hair / head / forehead / eyebrows

powieki / rzęsy / policzki / nos - eyelids / eye lashes / cheecks / nose

Wargi / podbródek / szyja / tył głowy - Lips / chin / neck / back of the head

zęby / białe zęby / żółte zęby / zdrowe zęby / złamane zęby - teeth / white teeth / yellow teeth / healthy teeth / broken teeth

Ramię / ręka / palce - Arm / hand / fingers

Ile palców - How many fingers

Każdy palec ma imię - Every finger has a name

Kciuk, a następnie palec wskazujący, palec środkowy, palec serdeczny i mały palec lub szpilka - Thumb, followed by index finger, middle finger, ring finger, and little finger or pinkie

ucho / uszy - ear / ears

Brzuch / noga / kolano / stopa - Stomach / leg / knee / foot

Twarz - face

Mam długie blond włosy, brązowe brwi, niebieskie oczy, czerwone usta i duży brzuch - I have long blond hair, brown eyebrows , blue eyes, red lips and a big belly

a ty - and you

Mam krótkie srebrne włosy - I have short silver hair

Mam brązowe brwi - I have brown eyebrows

Mam niebieskie / zielone oczy - I have blue / green eyes

piękne zdrowe zęby - beautiful healthy teeth

mały brzuch - small stomach

Twoje plecy - Your back

bezdomny jest kulturą - bum is cultural

tyłek nie jest kulturalny - ass is not cultural

policzki - cheecks

do usłyszenia - hear you later

trochę - a little

If you would like Skype lessons from kamila please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Polish Property Offers - http://roycoughlan.com/

View Details

We will learn polish - Nauczymy się polskiego

Of course - Oczywiście

Today we will be learning the plan for tomorrow - Dzisiaj poznamy plan na jutro

Please repeat - Proszę powtórzyć

I will be - będę

You will be - Będziesz

He / She will be  - On / Ona będzie

It will be - To będzie

We will be - Będziemy

They will be - Oni / One będą

I will be reading - Będę czytać

I will be eating - Będę jeść

I will be writing - Będę pisać

I will sleep - będę spał

I will swim - Będę pływał

I will learn - Nauczę się

Do you understand grammar - Czy rozumiesz gramatykę?

Now a question for you - Teraz pytanie do ciebie

What else - Co jeszcze

I will be running in the park - Będę biegał w parku

I will be playing squash - Będę grał w squasha

I will be reading a book - Będę czytać książkę

I will be with my son and play board games - Będę z synem i będę grać w gry planszowe

If you would like Skype lessons from kamila please visit http://polonuslodz.com/

All Polish Episodes / Speaking Podcast / Meditation Podcast / Polish Property Offers - http://roycoughlan.com/

View Details

In today's lesson we discussed the following:

I feel very good today - Czuję się bardzo dobrze dzisiaj

why - dlaczego

Because today I did Yoga & Meditation and I feel fantastic - Ponieważ dzisiaj ćwiczyłem jogę i medytację i czuję się fantastycznie

Do you understand - Czy rozumiesz

Railway Station - Stacja kolejowa

Please repeat - Proszę powtórzyć

I am going to the railway station - Idę na dworzec kolejowy

Please take me to the railway station - Proszę, zabierz mnie na dworzec kolejowy

I am at the railway station - Jestem na stacji kolejowej

We must buy a ticket - Musimy kupić bilet

We go to the cash desk - Idziemy do kasy

I would like a ticket - Chciałbym bilet

What type of ticket - Jaki rodzaj biletu

A ticket can be normal or with discount - Bilet może być normalny lub ze zniżką

One normal ticket to Kracow/ Warsaw / Lodz / Gdansk - Jeden normalny bilet do Krakowa / Warszawy / Łodzi / Gdańska

What class - Jaka klasa

1st class / 2nd Class / 3rd Class - Pierwsza klasa / druga klasa / trzecia klasa

We can practice - Możemy ćwiczyć

I am the cashier and you are the customer - Jestem kasjerem, a ty klientem

A ticket to Warsaw please - Poproszę bilet do Warszawy

What type of ticket - Jaki rodzaj biletu

What time - Jaki czas

What time is the next train - O której jest następny pociąg

The next train is 1pm - Następny pociąg to 13.00

58zl please - 58zł proszę

I thought it would be cheaper - Myślałem, że będzie taniej

Second Class 48zl - Druga klasa 48zl

Third class 30zl - Trzecia klasa 30zł

I will be with the animals - Będę ze zwierzętami

Will you pay by cash or credit card - Czy zapłacisz gotówką czy kartą kredytową?

Normal train / Fast train / Express train / Intercity - Pociąg normalny / pociąg szybki / pociąg ekspresowy / intercity

It must be that train - To musi być ten pociąg

How long will the train take - Jak długo potrwa pociąg

one hour fifteen minutes - godzina piętnaście minut

To get Polish Skype Lessons please visit http://polonuslodz.com/

To find all our Polish Podcast Episodes / Speaking Podcast / Meditation Podcast and offers for Polish Property please visit http://roycoughlan.com/

View Details

In today's episode we discussed:

How do you feel - Jak się czujesz

Good and you - Dobrze, a ty

What is the topic today - Jaki jest dziś temat

There is a very popular phrase - Istnieje bardzo popularne zdanie -

Excuse me where is - Przepraszam, gdzie jest

Where is the Hotel Ibis - Gdzie jest hotel Ibis

Where is the Railway station - Gdzie jest dworzec kolejowy

Where is the Hospital - Gdzie jest szpital

Where is the closest Post Office - Gdzie jest najbliższy urząd pocztowy

Please repeat - Proszę powtórzyć

Where is the Bus Station - Gdzie jest przystanek autobusowy

How can I get to the centre - Jak mogę dostać się do centrum

Take a Taxi - Wziąć taksówkę

How can I get to the Museum - Jak mogę dostać się do muzeum

I'm lost Man / Woman - Jestem zagubiony Mężczyzna / Kobieta

Where is the Pharmacy - Gdzie jest apteka

Please go straight - Proszę idź prosto

or please turn left - lub proszę skręcić w lewo -

Please turn right - Proszę skręcić w prawo

Where is the hotel Hilton - Gdzie jest hotel Hilton

Around 10 minutes on foot - Około 10 minut na piechotę

Please go straight, later turn right and straight again - Proszę iść prosto, potem skręcić w prawo i znowu prosto

I'm not from here - Nie jestem stąd

Where is the Museum - Gdzie jest Muzeum

We have a few museums in our city - W naszym mieście mamy kilka muzeów

Go straight to the end of the street and then turn right - Idź prosto na koniec ulicy, a następnie skręć w prawo

The museum is there - Muzeum jest tam

At the end of the street - Na końcu ulicy

View Details

Today is a super day - Dzisiaj jest super dzień

Why - Dlaczego

Today is Monday - Dziś jest poniedziałek

Do you know the days of the week? - Czy znasz dni tygodnia?

Monday - poniedziałek

Tuesday - wtorek

Wednesday - środa

Thursday - czwartek

Friday - piątek

Saturday - sobota

Sunday - niedziela

Roy what do you do on Monday - Roy, co robisz w poniedziałek

On Monday I study - W poniedziałek studiuję

Polish language /Economics / Medicine - Język polski / ekonomia / medycyna

On Tuesday I go to the Gym - We wtorek idę na siłownię

On Wednesday I go to a Toastmasters meeting - W środę idę na spotkanie Toastmasters

On Thursday I work - W czwartek pracuję

On Friday I am with my son and we play - W piątek jestem z synem i gramy

I go to the park on Saturday - Idę do parku w sobotę

Lazy day on Sunday - Leniwy dzień w niedzielę

I do nothing - ja nic nie robię

Kamila what do you do on Monday - Kamila, co robisz w poniedziałek

I have Polish lessons on Monday - Mam lekcje polskiego w poniedziałek

I have yoga lessons on Tuesday - Mam lekcje jogi we wtorek

I meditate on Wednesday(http://meditationpodcast.org/) - Medytuję w środę

On Thursday I walk in the park - W czwartek chodzę po parku

On Friday I listen to relaxing music - W piątek słucham relaksującej muzyki

On Saturday I shop in the supermarket - W sobotę robię zakupy w supermarkecie

I rest on Sunday - Odpoczywam w niedzielę

And what do you do on Sunday? - A co robisz w niedzielę?

We wait for your comments - Czekamy na Twoje komentarze

Thank you very much - Dziękuję Ci bardzo

Find all Episodes along with the Meditation Podcast & the Speaking Podcast at http://roycoughlan.com/

Get Polish Skype lessons at http://polonuslodz.com/

View Details

I am sitting in your school - Siedzę w twojej szkole

I am drinking coffee without caffeine - Piję kawę bez kofeiny

Today we continue the topic with food - Dziś kontynuujemy ten temat jedzeniem

Today will be vegetables - Dzisiaj będą warzywa

One Vegetable - Jedno warzywo

Vegetables - warzywa

Do you like vegetables - Czy lubisz warzywa

Children don't like vegetables - Dzieci nie lubią warzyw

What vegetables do you know - Jakie znasz warzywa?

Cauliflower - kalafior

Broccoli - brokuły

Tomato - Pomidor

What else - Co jeszcze

Potato - Ziemniak

Carrot - Marchewka

Parsnip - Pasternak

Garlic - czosnek

Onion - Cebula

Sharlots - Sharlots

Green Onions - Zielone cebule

Cucumber - Ogórek

Peppers - Red / Green / Yelow : Papryka - Czerwona / Zielona / Żółta

Beans - fasolki

Peas / Green peas - Groch / zielony groszek

Lettuce - Sałata

Salad - Sałatka

Very good - Bardzo dobre

What vegetable do you like - Jakie warzywa lubisz

Carrot - Marchewka

Only carrot - Tylko marchewka

Anything else - Coś jeszcze

Rocket - Rukola

I like lentils - Lubię soczewicę

I really like sweet potatoes - Naprawdę lubię słodkie ziemniaki

Big sweet potatoes - Duże słodkie ziemniaki

How do you cook - Jak gotujesz

I do not cook I bake - Nie gotuję, pieczę

Cut them like chips - Pokrój je jak frytki

Generally vegetables are very healthy - Ogólnie warzywa są bardzo zdrowe

My son really likes fresh green cucumber - Mój syn naprawdę lubi świeży zielony ogórek

Vegetables have lots of vitamins - Warzywa mają dużo witamin

Tasty Topic - Smaczny temat

If you would like to find all lessons please visit www.roycoughlan.com

You will also find the Speaking Podcast & Meditation Podcast

If you would like Skype lessons from Kamila visit www.polonuslodz.com

View Details

O czym dzisiaj będziemy rozmawiać -  What will we be talking about today

Dzisiaj porozmawiamy o owocach -  Today we will talk about fruit 

Jestem wegetarianinem i bardzo lubię owoce -  I am a vegetarian and I like fruit very much

Czy rozumiesz - Do you understand

Jakie owoce znasz po polsku? - What fruit do you know in Polish

Jabłko - Apple

Pomarańczowy - Orange

Truskawka - Strawberry 

Malina - Rasberry

Banan - Bananna

Winogrona - Grapes

Brzoskwinia - Peach

Gruszka - Pear

Ananas - Pinapple

Arbus   - Water Mellon

Jagody -  Berries

Jaki owoc lubisz -   What fruit do you like

Avacado -  Avacado

Kiwi - kiwi

Cytrynowy -   Lemmon

Limonka -   Lime

Co lubisz -  What do you like

Lubisz wszystko - You like everything

Wolę się zmieniać, ponieważ nie lubię codziennie jeść tych samych owoców -   I prefer to change as I don't like to eat the same fruit everyday

Moim ulubionym owocem jest -   My favourite fruit is

Czasami  - Sometimes

Proszę powtórzyć -  Please repeat

Owoce / Owoce -   Fruit / Fruits

Mango -   Mango

Lubię koktajl z mango - I like a mango smoothie

Jagody -   Blueberries

Dziękuję Cie -  Thank you 

Do widzenia - Good bye

View Details

jestem głodny - I am hungry

Idziemy do sklepu - We are going to the shop

idę do sklepu - I am going to the shop

Czy lubisz zakupy? - Do you like shopping?

Lubię gotować - I like to cook

Chleb - Bread

Bułka - Bread Roll

masło - Butter

Herbata - Tea

Kawa - Coffee

Woda mineralna - Mineral Water

Gaz lub bez gazu - Gas or without gas

Ser - Cheese

Jogurt - Yogurt

Kg Pomidorów - Kg of Tomatoes

Kg ziemniaków - Kg of Potatoes

Kg bananów - Kg of Bananas

Kg ogórka - Kg of Cucumber

Kg cukru - Kg of Sugar

Kg jabłek - Kg of Apples

Kg pomarańczy - Kg of Oranges

Idziemy do sklepu - We go to the shop

Dzień dobry - Good morning

Proszę - Please

Co byś chciał - What would you like

Coś jeszcze - Anything else

Nie, dziękuję - No Thanks

To wszystko - Thats all

Czy mogę płacić kartą - Can I pay by card

Oczywiście - Of course

Do widzenia - Good bye

Miłego dnia - Have a good day

Nawzajem - Same to you

To get Skype lessons in Polish visit http://polonuslodz.com/

To listen to my Speaking Podcast or Meditation Podcast please visit http://roycoughlan.com

View Details

What time is it - Która godzina

1:00 a.m. - 1:00 (pierwsza/pierwsza rano)

2:00 a.m. - 2:00 (druga/druga rano)

3:00 a.m. - 3:00 (trzecia/trzecia rano)

4:00 a.m. - 4:00 (czwarta/czwarta rano)

5:00 a.m. - 5:00 (piąta/piąta rano)

6:00 a.m. - 6:00 (szósta/szósta rano)

7:00 a.m. - 7:00 (siódma/siódma rano)

8:00 a.m. - 8:00 (ósma/ósma rano)

9:00 a.m. - 9:00 (dziewiąta/dziewiąta rano)

10:00 a.m. - 10:00 (dziesiąta/dziesiąta rano)

11:00 a.m. - 11:00 (jedenasta/jedenasta rano)

12:00 p.m. - 12:00 (dwunasta/dwunasta w południe)

1:00 p.m. - 13:00 (trzynasta/pierwsza popołudniu)

2:00 p.m. - 14:00 (czternasta/druga popołudniu)

3:00 p.m. - 15:00 (piętnasta/trzecia popołudniu)

4:00 p.m. - 16:00 (szesnasta/czwarta popołudniu)

5:00 p.m. - 17:00 (siedemnasta/piąta popołudniu)

6:00 p.m. - 18:00 (osiemnasta/szósta popołudniu)

7:00 p.m. - 19:00 (dziewiętnasta/siódma wieczorem)

8:00 p.m. - 20:00 (dwudziesta/ósma wieczorem)

9:00 p.m. - 21:00 (dwudziesta pierwsza/dziewiąta wieczorem)

10:00 p.m. - 22:00 (dwudziesta druga/dziesiąta wieczorem)

11:00 p.m. - 23:00 (dwudziesta trzecia/jedenasta wieczorem)

12:00 a.m. - 24:00 (dwudziesta czwarta/północ)

To get Skype lessons in Polish please visit www.polonuslodz.com

Meditation Podcast can be found at www.meditationpodcast.org

A Speaking Podcast can be found at www.speakingpodcast.com

To find out more www.roycoughlan.com

View Details

  • 0 – zero
  • 1 – jeden
  • 2 – dwa
  • 3 – trzy
  • 4 – cztery
  • 5 – pięć
  • 6 – sześć
  • 7 – siedem
  • 8 – osiem
  • 9 – dziewięć
  • 10 – dziesięć

  • 11 – jedenaście

  • 12 – dwanaście
  • 13 – trzynaście
  • 14 – czternaście
  • 15 – piętnaście
  • 16 – szesnaście
  • 17 – siedemnaście
  • 18 – osiemnaście
  • 19 – dziewiętnaście
  • 20 – dwadzieścia

  • 30 – trzydzieści

  • 40 – czterdzieści
  • 50 – pięćdziesiąt
  • 60 – sześćdziesiąt
  • 70 – siedemdziesiąt
  • 80 – osiemdziesiąt
  • 90 – dziewięćdziesiąt

  • 100 – sto

  • 1,000 - tysiąc
  • 1,000,000 - jeden milion
  • $1,000,000,000 - miliard dolarów
  • Math = matematyka
    • = plus
    • = minus
  • X = pomnożone
  • / = Divided by podzielony przez

To get Skype lessons please visit www.polonuslodz.com

To learn how to speak in Public www.speakingpodcast.com

To Meditate www.meditationpodcast.org

View Details

Ubranie - Clothes

Czy znasz ubrania po polsku? - Do you know clothes in Polish

Co to jest - What is that

Koszula - Shirt

Spodnie - Pants

Bluza - Blouse

Spodnie jeansowe - Jeans

Sukienka - Dress

Spódnica - Skirt

Jaki kolor lubisz - What colour do you like

Kolorowy - Colourful

Kiedy jest zimno - When its cold

Kapelusz - Hat

Czapka - Cap

Szalik - Scarf

płaszcz / kurtka - coat / Jacket

Rękawiczki - Gloves

noszę na sobie - I am wearing

Mam niebieską bluzkę i czarne dżinsy - I have a blue blouse and black jeans

Co masz na sobie - What are you wearing

Ciemnoniebieska koszula i jasnoniebieskie spodnie - A dark blue shirt and light blue pants

Buty - Shoes

Mam brązowe buty - I have brown shoes

Jakie masz buty? - What type of shoes have you got

Skarpety - Socks

majtki - briefs

Kamizelka - Vest

Oczywiście - Of course

To get Skype Lessons www.polonuslodz.com

To learn to Speak in Public www.speakingpodcast.com

To Meditate www.meditationpodcast.org

To Learn more about me www.roycoughlan.com

View Details

O czym będziemy rozmawiać - What will we talk about

Jak się czujesz - How do you feel

Dobrze dziękuję, a ty - Good thanks and you

Świetnie, mam dużo energii - Great, I have lots of energy

Bank - Bank

Idę do banku - I go to the Bank

Gdzie idziesz - Where are you going

Gdzie jesteś - Where are you

Jestem w banku - I am in the Bank

Co robimy w banku - What do we do in the Bank

Otworzyć konto - Open an account

Konto prywatne lub biznesowe - Private account or business account

Czy masz konto prywatne? - Do you have a private account?

Czy masz konto firmowe? - Do you have a company account?

Dobrze, że masz konto prywatne i firmowe - Good you have a private and company account

Zamknij konto - Close an account

Dzień dobry, chciałbym otworzyć / zamknąć konto - Good day, I would like to open / close an account

Możemy wykonać przelew - We can do a transfer

Chciałbym zrobić transfer - I would like to do a transfer

Wpłać pieniądze na konto - Pay money into the account

Co jeszcze możemy zrobić - What else can we do

Weź pieniądze z konta - Take money from the account

Podobnie jak bankomat, możesz brać pieniądze - Same as an ATM, you can take money

słucham - I'm listening

Chciałbym otworzyć konto - I would like to open an account

Co jeszcze - What else

Ile - How much

Dwadzieścia tysięcy - Twenty thousand

To get Private Skype lessons please visit www.polonuslodz.com

To learn how to speak in Public please visit www.speakingpodcast.com

To learn different types of Meditation please visit www.meditationpodcast.org

To contact or learn more about me please visit www.roycoughlan.com

View Details

Poczta - Post Office

Jestem na poczcie - I am at the Post Office

Proszę powtórzyć - Please repeat

Gdzie idziesz - Where are you going

Koperta - Envelope

Znaczek - Stamp

Ile to kosztuje - How much does it cost

Ile kosztuje koperta - How much does an envelope cost

Koperta kosztuje 0,50 grosza - An envelope costs 0,50 pennies

Ile kosztuje znaczek - How much does a stamp cost

Dobry dzień - Good day

Chciałbym kopertę - I would like an envelope

Jaki rozmiar - What size

Co robimy na poczcie - What do we do at the post office

Wysłać list - To send a letter

Chciałbym wysłać list - I would like to send a letter

Możemy wziąć paczkę - We can take a package

Chciałbym wziąć paczkę - I would like to take a package

Co byś chciał - What would you like

Poproszę małą kopertę - A small envelope please

Coś jeszcze - Anything else

Poproszę znaczek do Irlandii - A stamp to Ireland please

Chciałbym wysłać list do Irlandii - I would like to send a letter to Ireland

Ile to kosztuje - How much does it cost

Czy płacisz kartą czy gotówką? - Do you pay by card or cash?

Oto twoja zmiana - Here is your change

Dziękuję i do widzenia - Thank you and good bye

Teraz możesz iść na pocztę i poćwiczyć - Now you can go to the Post Office and practice

If you would like to improve speaking in public you can get great tips at www.speakingpodcast.com

If you are interested in Meditation please visit www.meditationpodcast.org

To learn more about me please visit www.roycoughlan.com

View Details

Jaki jest Twój zawód - What Is your Profession

Nauczyciel - Teacher

Architekt - Architect

Lekarz - Doctor

Kelner - Waiter

Biznesmen - Businessman

Proszę powtórzyć - Please repeat

Urzędnik - Clerk

Dentysta - Dentist

Dziennikarz - Journalist

Kierowca - Driver

Jaki zawód masz? - What profession have you

Jestem biznesmenem - I am a businessman

Co robi biznesmen - What does a businessman do

Mam firmę z branży nieruchomości - I have a real estate company

Proszę zapytaj mnie - Please ask me

kim jesteś z zawodu - What is your profession

Jestem nauczycielem - I am a teacher

Co robi nauczyciel - What does a teacher do

To zależy od rodzaju nauczyciela - It depends on the type of teacher

Oni uczą - They Teach

Uczę polskiego - I teach Polish

gdzie uczysz polskiego - where do you teach Polish

W łódzkiej szkole Polonus - In Lodz school Polonus

Jestem nauczycielem i uczę polskiego - I am a teacher & teach Polish

Jesteś biznesmenem i masz firmę - You are a businessman and you have a company

czy masz 1 firmę czy 2 - do you have 1 company or 2

Mam kilka firm - I have a few firm

Jaki typ firmy - What type of company

Mam prywatny sąd, a jest to krajowy sąd arbitrażowy - I have a private court and it the national court of arbitration

Jesteś prawdziwym biznesmenem - You are a real businessman

Powodzenia - Good luck

do widzenia - good bye

To get Skype lesson visit www.polonuslodz.com

To learn how to speak in Public please visit www.speakingpodcast.com

Medation & Breathwork can be found at www.meditationpodcast.org

The private court can be found at www.nationalcourtofarbitration.com

To find out more about me please visit www.roycoughlan.com

View Details

Hi - Cześć

How are you - Jak się masz

Good thank you - Dobrze dziękuję

I'm also good - Jestem także dobry

The weather is not nice - Pogoda nie jest ładna

It's raining - Pada deszcz

Where are you going - Gdzie idziesz

for what you are going - za co idziesz

I go to the shop for shopping - Idę do sklepu na zakupy

I go to the restaurant for lunch - Idę do restauracji na lunch

I want tomato soup - Chcę zupę pomidorową

and you - a ty

Duck - Kaczka

Duck with potatoes - Kaczka Z Ziemniakami

I go to the coffee shop for coffee - Idę do kawiarni na kawę

I like coffee with soya milk - Lubię kawę z mlekiem sojowym

and you - a ty

I like black coffee - Lubię czarną kawę

At the weekend I go to the cinema for a movie - W weekend idę do kina na film

Do you like movies - Czy lubisz filmy

Yes, I really like movies - Tak, naprawdę lubię filmy

What type of movie do you like - Jaki rodzaj filmu lubisz

Comedy - Komedia

American comedy, British comedy - Amerykańska komedia, brytyjska komedia

I go to the theatre for a show - Idę do teatru na przedstawienie

Do you like the theatre - Czy podoba ci się teatr

Do you go to the theatre for a show? - Czy idziesz do teatru na przedstawienie?

Very rarely - Bardzo rzadko

But I think you go to a disco club - Ale myślę, że idziesz do klubu disco

Also very rarely - Również bardzo rzadko

I go to the disco club - Chodzę do klubu disco

I like the park - Lubię park

Today I am going to the park for a walk - Dzisiaj idę do parku na spacer

I go to the museum for an exhibition - Idę do muzeum na wystawę

A little boring - Trochę nudne

I go to the opera for a concert - Idę do opery na koncert

Are you interested in music? - Czy interesujesz się muzyką?

What type of music do you like? - Jaki rodzaj muzyki lubisz?

Classical music - Muzyka klasyczna

I like classical music - Lubię muzykę klasyczną

I go to the opera for a concert - Idę do opery na koncert

Roy you need to go to school to learn Polish - Roy, musisz iść do szkoły, aby uczyć się polskiego

Where is the best place to learn? - Gdzie jest najlepsze miejsce do nauki?

Of course at Plac Wolnosci Polonus school - Oczywiście w szkole Plac Wolnosci Polonus

Do you have Skype lessons? - Czy masz lekcje Skype?

Yes of course - Tak oczywiście

Thank you - Dziękuję Ci

Good bye - Do widzenia

To order your lessons visit Polonuslodz.com ,If you are a new client mention this podcast to get a 10% discount on class lessons or Skype lessons.

To learn how to speak in Public in English please visit speakingpodcast.com

for nice relaxing Meditation please visit meditationpodcast.org

To learn more about me visit roycoughlan.com

View Details

In this episode you will learn to say: - W tym odcinku nauczysz się mówić:

Travelling - Podróżowanie

To travel - Podróżować

I travel - Podróżuję

You travel - Podróżujesz

Do you like to travel - Czy lubisz podróżować

I like to travel - Lubię podróżować

Where do you like to travel - Gdzie lubisz podróżować

I like to travel to other countries - Lubię podróżować do innych krajów

France / Portugal / Spain - Francja / Portugalia / Hiszpania

To Greece - Do Grecji

To Croatia - Do Chorwacji

To Italy - Do Włoch

Who do you travel with - Z kim podróżujesz

With my friends - Z moimi przyjaciółmi

When do you like to travel - Kiedy lubisz podróżować

All year - Cały rok

How long do you like to travel for - Jak długo lubisz podróżować

Sometimes 3 days is good - Czasami 3 dni są dobre

Sometimes 2 weeks - Czasami 2 tygodnie

Now I travel to Croatia for 1 month - Teraz podróżuję do Chorwacji na 1 miesiąc

What are you doing on holidays? - Co robisz na wakacjach?

I like to have a morning walk on the beach - Lubię poranny spacer po plaży

Do you like to sunbath - Czy lubisz się opalać?

What else do you like to do - Co jeszcze lubisz robić

I like to go to local restaurants - Lubię chodzić do lokalnych restauracji

Do you like to read books - Czy lubisz czytać książki

Yes, but when on holidays I do not have time to read - Tak, ale kiedy jestem na wakacjach, nie mam czasu na czytanie

So what are you doing - Więc co robisz

I go to the museum - chodzę do muzeum

I go to the disco - Chodzę na dyskotekę

I wish you an amazing trip - Życzę Ci niesamowitej podróży

Have fun - Baw się dobrze

See you in 4 weeks - Do zobaczenia za 4 tygodnie

View Details

Good Day - Dzien dobry

Hair - włosy

Can be long - Może być długi

Long hair - Długie włosy

I have long hair - Mam długie włosy

I have short hair - Mam krótkie włosy

I have long straight hair - Mam długie proste włosy

I have short curley hair - Mam krótkie kręcone włosy

What kind of hair have you - Jakie masz włosy?

What colour - Jaki kolor

I have short white hair - Mam krótkie białe włosy

I have long blond hair - Mam długie blond włosy

Hairdressor - Fryzjer

We are going to the hairdressor - Idziemy do fryzjera

How can I help you - Jak mogę ci pomóc

To colour hair - Kolor włosów

My hair grows fast - Moje włosy rosną szybko

Cut my hair - Obetnij moje włosy

I would like my hair cut short - Chciałbym, żeby moje włosy były krótkie

What is the price - Jaka jest cena

To make a perm - Aby zrobić pozwolenie

I would like to colour my hair blond - Chciałbym pokolorować włosy blond

Thank you - Dziękuję

To get private Skype lessons please visit www.polonuslodz.com

To learn how to be a better public speaker in English please visit www.speakingpodcast.com

Other opportunities visit www.roycoughlan.com

View Details

About eating - o jedzeniu

Are you hungry -  jesteś głodny

Me also - Ja też

What do you eat for lunch - co jesz na obiad

What do you have for 1st course - co masz na pierwszy kurs

Garlic Bread - chleb czosnkowy

What else - co jeszcze Chcę

Chicken with potatoes - kurczaka z ziemniakami

What do you want to drink - co chcesz pić

For me mineral water without gas - dla mnie woda mineralna bez gazu

Tomato Soup with noodles - zupa pomidorowa z makaronem

Rice and vegetables - ryż z warzywami

What do you offer - co oferujesz

I have very fresh orange juice - mamy bardzo świeży sok pomarańczowy

Apple pie - szarlotka

For me chocolate ice cream  - dla mnie lody czekoladowe

Enjoy your meal - smacznego 

If you would like to get Polish lessons please visit polonuslodz.com

To learn how to speak in public in English please visit speakingpodcast.com

Meditation podcast is available at meditationpodcast.org